KEGG   Marivirga tractuosa: Ftrac_0670Help
Entry
Ftrac_0670        CDS       T01365                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mtt  Marivirga tractuosa
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mtt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
843081..843782
Genome map
AA seq 233 aa AA seqDB search
MSNTPQNKNRDLENINELEEFGDDHVASNFETPLRADAFEMDDDLKMEMIAKHFKEIMHI
LGMDLSDDSLKGTPNRVAKMYVKEVFSGLNPKNKPQPKLFENKYKYSQMLVEKDITFYSH
CEHHFVPIYGKAHVAYISSGKVIGLSKINRIVQYYSKRPQVQERLTVQIAEELKEVMQTE
DVAVVMDANHMCVSSRGVGDTNSRTGTSYFGGKFNDEATRREFLDYINSPNNS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataccccacagaataaaaatagagatttggaaaatattaatgagcttgaagaa
ttcggtgatgatcatgtagcatcaaattttgaaactccattaagagccgatgcctttgaa
atggatgatgacttgaaaatggaaatgattgctaagcattttaaggaaatcatgcacatt
ctgggtatggatttaagcgatgatagcttgaaaggaactccaaacagagtggctaaaatg
tatgtaaaagaagtattcagtggattgaacccaaaaaacaaaccacaaccgaagcttttt
gagaataaatataagtacagtcaaatgttagtagaaaaggatatcaccttctactcgcat
tgtgagcatcactttgttccaatttatggaaaagcgcatgtggcatatatttcaagtggg
aaggttattggtttatcaaaaatcaatagaattgttcagtactattcgaaaagaccacaa
gtgcaggaaagactaacagttcaaattgctgaggaattgaaagaagtaatgcaaacggaa
gatgtagcagttgttatggatgcgaatcacatgtgtgtttcttcccgtggcgtaggggat
accaatagccgcacaggaacttcttattttggtggtaaatttaatgatgaagctacaaga
agagaatttttggattacattaattctcctaataatagctaa

DBGET integrated database retrieval system