KEGG   Marivirga tractuosa: Ftrac_0670Help
Entry
Ftrac_0670        CDS       T01365                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mtt  Marivirga tractuosa
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ftrac_0670
Enzymes [BR:mtt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ftrac_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
843081..843782
Genome map
AA seq 233 aa AA seqDB search
MSNTPQNKNRDLENINELEEFGDDHVASNFETPLRADAFEMDDDLKMEMIAKHFKEIMHI
LGMDLSDDSLKGTPNRVAKMYVKEVFSGLNPKNKPQPKLFENKYKYSQMLVEKDITFYSH
CEHHFVPIYGKAHVAYISSGKVIGLSKINRIVQYYSKRPQVQERLTVQIAEELKEVMQTE
DVAVVMDANHMCVSSRGVGDTNSRTGTSYFGGKFNDEATRREFLDYINSPNNS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataccccacagaataaaaatagagatttggaaaatattaatgagcttgaagaa
ttcggtgatgatcatgtagcatcaaattttgaaactccattaagagccgatgcctttgaa
atggatgatgacttgaaaatggaaatgattgctaagcattttaaggaaatcatgcacatt
ctgggtatggatttaagcgatgatagcttgaaaggaactccaaacagagtggctaaaatg
tatgtaaaagaagtattcagtggattgaacccaaaaaacaaaccacaaccgaagcttttt
gagaataaatataagtacagtcaaatgttagtagaaaaggatatcaccttctactcgcat
tgtgagcatcactttgttccaatttatggaaaagcgcatgtggcatatatttcaagtggg
aaggttattggtttatcaaaaatcaatagaattgttcagtactattcgaaaagaccacaa
gtgcaggaaagactaacagttcaaattgctgaggaattgaaagaagtaatgcaaacggaa
gatgtagcagttgttatggatgcgaatcacatgtgtgtttcttcccgtggcgtaggggat
accaatagccgcacaggaacttcttattttggtggtaaatttaatgatgaagctacaaga
agagaatttttggattacattaattctcctaataatagctaa

DBGET integrated database retrieval system