KEGG   Marivirga tractuosa: Ftrac_0713Help
Entry
Ftrac_0713        CDS       T01365                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mtt  Marivirga tractuosa
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_0713
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ftrac_0713
   00640 Propanoate metabolism
    Ftrac_0713
   00660 C5-Branched dibasic acid metabolism
    Ftrac_0713
Enzymes [BR:mtt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ftrac_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(888290..889501)
Genome map
AA seq 403 aa AA seqDB search
MNIHEYQAKGILEKYGVTIQKGIVADTPEEATEAAKKLNKETGTEWYVLKAQIHAGGRGK
GKVKETDSNGVVLAKSLEDVAPKSKAILGGTLVTHQTGEEGKLVSKLLVAQDVYYPGEHE
PKEYYVGILLDRAKGCNVIMASTEGGVDIEDVAENTPDKIIKEWIDPRVGLQGFQARKVA
FKLGLEGDAFKNMVKFIHSLYTAYDATDSSMFEINPVLKTSDNKILAVDAKVNLDDSALY
RHKDLADMRDKSEEDPAEVEAAESGLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGDPA
NFLDVGGSANAETVEAGFRIILKDPKVEAILINIFGGIVRCDRVAKGVVEAYKNIGDIKV
PIIVRLQGTNAEEGAKIIEDSGLKVTSAIVLKDAALRVKEALA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaagccaaaggaatacttgaaaagtacggagtaaccattcaa
aaaggaatcgttgccgatacaccagaagaagctacagaagctgctaaaaagctcaataaa
gagactggaactgagtggtatgtgcttaaagcgcaaatccatgcaggaggaagaggaaaa
gggaaagtgaaggaaacagactcaaatggagtagttttagcgaaaagcttagaagatgta
gcgccaaaatctaaagctattttaggaggtactttagtgacgcatcaaactggtgaagaa
ggtaaattggttagcaaattattagtagctcaggatgtatattatccaggcgaacatgag
ccaaaagaatattatgttggaatcttattggatagagccaaaggatgcaatgtaatcatg
gcttctactgaagggggtgttgatattgaagatgttgcagaaaatactccagataaaatt
attaaagagtggattgaccctcgtgtaggcctacaaggatttcaagccagaaaagtagct
ttcaaattaggtttagaaggcgatgctttcaaaaacatggtgaaatttatccattcatta
tacaccgcttatgatgctacggattcttcaatgtttgaaatcaacccagtgttgaaaaca
tctgacaataaaattttagcagtggatgctaaagtgaatttagatgattctgctttatat
cgtcacaaggatttagccgatatgcgagataaatctgaggaagatcctgccgaagtggaa
gcagctgaatcaggcttaaactatgtgaaattggatggtaatgtgggctgtatggtaaat
ggtgctggattagcaatggctactatggatattatcaaattatcaggtggtgacccagcc
aacttcttggatgttgggggtagtgctaatgcggaaacagtagaagctggtttcagaatt
atcttaaaagacccaaaagttgaagccatcttaatcaatatctttggtggtatcgttcgt
tgcgatagagtggctaaaggtgtggttgaagcttacaaaaacataggagatataaaagtg
ccaatcatcgttcgtttacaaggaacaaatgctgaagaaggtgcaaaaatcatagaagat
tcaggcttgaaagttacttctgctatcgtattgaaagatgcagcattaagagtgaaagaa
gcactggcttaa

DBGET integrated database retrieval system