KEGG   Marivirga tractuosa: Ftrac_0713Help
Entry
Ftrac_0713        CDS       T01365                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00020  Citrate cycle (TCA cycle)
mtt00640  Propanoate metabolism
mtt00660  C5-Branched dibasic acid metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01130  Biosynthesis of antibiotics
mtt01200  Carbon metabolism
Module
mtt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ftrac_0713
   00640 Propanoate metabolism
    Ftrac_0713
   00660 C5-Branched dibasic acid metabolism
    Ftrac_0713
Enzymes [BR:mtt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ftrac_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADR20715
JGI: Ftrac_0713
UniProt: E4TRW4
Position
complement(888290..889501)
Genome map
AA seq 403 aa AA seqDB search
MNIHEYQAKGILEKYGVTIQKGIVADTPEEATEAAKKLNKETGTEWYVLKAQIHAGGRGK
GKVKETDSNGVVLAKSLEDVAPKSKAILGGTLVTHQTGEEGKLVSKLLVAQDVYYPGEHE
PKEYYVGILLDRAKGCNVIMASTEGGVDIEDVAENTPDKIIKEWIDPRVGLQGFQARKVA
FKLGLEGDAFKNMVKFIHSLYTAYDATDSSMFEINPVLKTSDNKILAVDAKVNLDDSALY
RHKDLADMRDKSEEDPAEVEAAESGLNYVKLDGNVGCMVNGAGLAMATMDIIKLSGGDPA
NFLDVGGSANAETVEAGFRIILKDPKVEAILINIFGGIVRCDRVAKGVVEAYKNIGDIKV
PIIVRLQGTNAEEGAKIIEDSGLKVTSAIVLKDAALRVKEALA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaagccaaaggaatacttgaaaagtacggagtaaccattcaa
aaaggaatcgttgccgatacaccagaagaagctacagaagctgctaaaaagctcaataaa
gagactggaactgagtggtatgtgcttaaagcgcaaatccatgcaggaggaagaggaaaa
gggaaagtgaaggaaacagactcaaatggagtagttttagcgaaaagcttagaagatgta
gcgccaaaatctaaagctattttaggaggtactttagtgacgcatcaaactggtgaagaa
ggtaaattggttagcaaattattagtagctcaggatgtatattatccaggcgaacatgag
ccaaaagaatattatgttggaatcttattggatagagccaaaggatgcaatgtaatcatg
gcttctactgaagggggtgttgatattgaagatgttgcagaaaatactccagataaaatt
attaaagagtggattgaccctcgtgtaggcctacaaggatttcaagccagaaaagtagct
ttcaaattaggtttagaaggcgatgctttcaaaaacatggtgaaatttatccattcatta
tacaccgcttatgatgctacggattcttcaatgtttgaaatcaacccagtgttgaaaaca
tctgacaataaaattttagcagtggatgctaaagtgaatttagatgattctgctttatat
cgtcacaaggatttagccgatatgcgagataaatctgaggaagatcctgccgaagtggaa
gcagctgaatcaggcttaaactatgtgaaattggatggtaatgtgggctgtatggtaaat
ggtgctggattagcaatggctactatggatattatcaaattatcaggtggtgacccagcc
aacttcttggatgttgggggtagtgctaatgcggaaacagtagaagctggtttcagaatt
atcttaaaagacccaaaagttgaagccatcttaatcaatatctttggtggtatcgttcgt
tgcgatagagtggctaaaggtgtggttgaagcttacaaaaacataggagatataaaagtg
ccaatcatcgttcgtttacaaggaacaaatgctgaagaaggtgcaaaaatcatagaagat
tcaggcttgaaagttacttctgctatcgtattgaaagatgcagcattaagagtgaaagaa
gcactggcttaa

DBGET integrated database retrieval system