KEGG   Marivirga tractuosa: Ftrac_0800Help
Entry
Ftrac_0800        CDS       T01365                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mtt  Marivirga tractuosa
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mtt00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mtt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
979846..980775
Genome map
AA seq 309 aa AA seqDB search
MTNLSVNHLLGIKDLTEEDIQLIFQTADHFKEVINRPIKKVPSLRDITIANIFFENSTRT
KLSFELAEKRLSADVVNFSSSNSSVKKGETLLDTVNNILSMKVDMVVMRHSSPGAAHFLS
RHINANIVNAGDGTHEHPTQALLDTYSIREQIQEIKGKKVAIIGDILHSRVALSNIYALK
KLGAEVMVCGPATLLPKYISDLGVKTSWDVKEALEWCDVANILRIQLERQQLKYFPSLRE
YSLYYGVDRKLLDSIGKEIIVMHPGPINRGVEISSDVADSKQSIILNQVENGVAIRMAVL
YLLAQKRQN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttaagtgtaaatcatttattgggtatcaaagacttaacagaagaagatatt
caattgatttttcaaactgccgaccacttcaaagaagttattaatagacccattaaaaaa
gtcccatcgctaagagatataaccatagccaatatattctttgaaaattcaactagaaca
aaattatcgttcgaattggctgaaaaaagactatcggcagatgtcgtaaatttctcttct
tctaatagctctgttaaaaaaggagaaactttattagatacagtcaacaatattctttcc
atgaaagtggatatggtagtcatgcgacattcaagcccaggagctgcgcatttcctttca
agacacattaatgcgaatatagtaaacgcaggcgatggcactcatgaacatccaactcag
gctcttttagatacttactccataagagagcaaattcaggaaatcaaaggaaaaaaagtt
gcaatcatcggggacatcttacactcaagagtcgcattatcaaatatttacgccttaaaa
aagctgggtgccgaggttatggtttgcggtccagcaaccctattaccaaagtatatttca
gatttaggagtcaaaactagctgggatgtgaaagaagctttagaatggtgtgatgttgcc
aatattctacgaattcaattagaaagacagcaattaaaatacttcccttctttaagagaa
tattcgctctattatggtgttgacaggaagttattagacagtatcggtaaagaaattatc
gtaatgcatccaggaccgatcaatagaggggtggaaattagtagtgatgtggcagattct
aagcaatcaattattctaaatcaagtagaaaatggagtggctattagaatggctgtactt
tatttattggcacaaaaaagacagaattaa

DBGET integrated database retrieval system