KEGG   Marivirga tractuosa: Ftrac_0899Help
Entry
Ftrac_0899        CDS       T01365                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtt  Marivirga tractuosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_0899
   01230 Biosynthesis of amino acids
    Ftrac_0899
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_0899
   00030 Pentose phosphate pathway
    Ftrac_0899
   00051 Fructose and mannose metabolism
    Ftrac_0899
   00052 Galactose metabolism
    Ftrac_0899
  Energy metabolism
   00680 Methane metabolism
    Ftrac_0899
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ftrac_0899
Enzymes [BR:mtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ftrac_0899
Protein phosphatases and associated proteins [BR:mtt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ftrac_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1118856..1119827
Genome map
AA seq 323 aa AA seqDB search
MKKVAIMTSGGDAPGMNACLRAAVRGAVYHGVEIYGIYRGYDGMIEGDIVKMDSHSVSNI
IQKGGTILKSARSEEFKTKEGRKKAYNELQKLGIEGLITIGGDGTFTGAKIFYDEYGIPT
VGAPGTIDNDLFGTDYTIGFDTAVNTALGAIDKIRDTADSHNRLFFIEVMGRDSGYIAIR
SGIGGGAELVMVPETSTSIKEVISTLQEGWARHKTSSIVVVAEGDEEGNAMEIAEKVKKQ
ISQKDIKVSILGHIQRGGSPSAQDRILASRLGLGALEGLMKGEKNVMAGIINDKLVYTSF
EDSITKNKPLNQELIHMVKVLSV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtagcaataatgacctctggtggagatgctcctggcatgaatgcatgcctt
agagctgctgttagaggggcagtataccatggagtggaaatatacggaatatatagaggt
tatgatgggatgattgaaggggatattgtaaaaatggattcacattcggtgagtaatatt
attcaaaaaggtggtactattctaaaatctgccagaagtgaagaatttaaaaccaaagaa
ggtcgaaaaaaggcctataatgaacttcagaaattaggaatagaaggtttgatcacaatt
ggtggggatggtacttttactggtgcaaaaattttctacgatgaatatggaattccaaca
gttggtgctccgggaaccatagataatgacctatttggaaccgactataccataggattt
gatactgcagtaaatacagctttaggtgcgatagataaaatacgtgatacagctgattct
cataaccgtcttttctttattgaagtaatgggtagagattctggttatattgccattcgt
tcgggcattggtgggggagctgaattagtgatggttcctgaaacctctaccagcattaag
gaagtgatcagtactttgcaggaaggttgggctcgtcacaagacatcatcgattgtagtg
gttgctgagggtgatgaagaagggaacgcaatggagattgcagagaaggtaaaaaaacaa
attagtcagaaagatattaaagtatccatactaggtcatattcagcgaggtggttcacct
agtgcacaagatcgaatattggcaagcagattaggattaggagccttagagggcttaatg
aaaggtgaaaagaacgtaatggctggtattattaatgacaaattggtttatacaagtttt
gaggacagcatcactaaaaacaaacctttaaatcaggaattaattcacatggttaaagtg
ttgagcgtctaa

DBGET integrated database retrieval system