KEGG   Marivirga tractuosa: Ftrac_0959Help
Entry
Ftrac_0959        CDS       T01365                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mtt  Marivirga tractuosa
Brite
Enzymes [BR:mtt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Ftrac_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1191368..1192303)
Genome map
AA seq 311 aa AA seqDB search
MLFYEKKLSGDNSMSCATCHQQSKAFTDGKAFSPGIDGINGKVSTMSLVNLLWAEKFTWN
GQMETVEAQSTEPIRNPIEMHENFDNAIQKLQDAGYNTLFQEAFDTDQITEELIGKALAQ
FQRALISSNSKYDQYLRGEYEPTQSERRGEQLFFTHPIPGQLRGGNCGDCHLGPLTSGAI
DEFQGFHNNGLDNDENMDEGLMAVTGDPKDKGRFKTPSLRNIALTAPYMHDGRFETLKEV
IEHYDNGIHQSSTLDVLIIEGSNESQAAGERPQLFLTDQEKEDILAFLHMLTDEEFINNP
QFSNPFENENN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcttttttatgagaaaaaactttctggtgataacagcatgtcttgcgctacttgccat
caacaaagcaaagccttcactgacggtaaggcttttagcccgggaatagacggcataaat
ggaaaagtgagtactatgtctttggtgaatttgctttgggctgaaaaatttacttggaat
gggcagatggaaacagtagaggcacaatcaaccgaaccaattcgtaaccccattgaaatg
catgagaattttgataatgctattcaaaaattacaagatgcaggttataatacattattt
caagaagcatttgacactgatcaaatcacagaagaattaattggaaaagcattggctcaa
tttcaaagagcgttgatatcatctaattctaaatatgatcaatatttaagaggcgaatat
gaaccaactcaatctgaacgaagaggggagcaattgttttttacgcatccaattcctggt
cagttgagaggtggtaattgtggagactgccatttggggccacttacttctggtgcaatt
gatgaatttcaaggcttccataataatggtttggataatgatgaaaatatggatgaaggt
ttaatggcagtgactggagacccaaaagataaaggtagatttaaaactcctagcttaaga
aatatagctttaactgcaccatatatgcatgatggtagatttgaaactttaaaggaagtg
attgagcattacgacaatggaattcatcaaagcagtacattagatgttctaattatagaa
ggtagtaatgaaagtcaggctgcaggagaacgaccacaattattccttacagatcaggaa
aaagaagatattttggcatttctacatatgttaactgatgaagaatttattaataatcct
caattctctaatccatttgaaaatgaaaacaattaa

DBGET integrated database retrieval system