KEGG   Marivirga tractuosa: Ftrac_0967Help
Entry
Ftrac_0967        CDS       T01365                                 

Definition
tRNA(ile)-lysidine synthetase
Orthology
K04075  
tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
mtt  Marivirga tractuosa
Brite
Enzymes [BR:mtt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     Ftrac_0967
Transfer RNA biogenesis [BR:mtt03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Ftrac_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1204006..1205322)
Genome map
AA seq 438 aa AA seqDB search
MLSASFLDYIKKESLFNRHEHLLLAISGGLDSVVLAHLLKLTDFHFSMAHMNFQLRDEDS
NRDEKFVRELAKKLEVEVFVKRVEIDKEKGSTQLQARDLRYDWFRRLMKDHHFSKLLTAH
HANDLLETTLLNLIRGTGIKGLRSILPLHHNIARPLLFASKEQIKEYAEENSIEWREDVS
NASEKYKRNKMRHRVIPLLLKENPNLLSGIQQTTLRLRAAESVWDEKLAKIRKKYVFNRD
EGIRIDRRILKLPQMEVFLYEFLSDYGFNLAQLQSFKFRKIGAQLSSFSHTLVIDRGFLL
VNPISDEIQKQFFPIQIQLKDKLIKTPLGLFKWSFINKNDVDYSIGNKIVFIEANKLKEP
IELDLWKEGDKIQPIGMKGKKKISDILIDQKVPLPQKKKVMVLKSGGEIIWVIGHKFSDS
FKVKKDTTKILRIEYENS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtgcgtcatttttagattatataaaaaaagaaagcctttttaataggcatgaa
catttactccttgccattagtggcgggcttgattctgttgttttagctcatttgttgaaa
ctgactgattttcatttttcaatggctcatatgaattttcaattaagagatgaggattca
aatcgagatgagaaattcgttagagaattagcaaagaagttggaagttgaagtttttgtc
aagagagttgagattgataaggaaaaaggttctacacagcttcaggcaagggatttgcga
tatgattggttccgaagattgatgaaagatcatcattttagtaagttgttgactgctcat
catgcgaatgatttattagagacaactttattgaatttgattagagggacgggaataaaa
ggcctgagaagtattcttcctcttcatcataatattgccagaccattactttttgcaagc
aaagaacaaattaaggagtatgctgaggaaaacagcatcgaatggagggaggatgtttca
aatgcttcagaaaaatataaaaggaataaaatgagacatcgtgtcattcctttattattg
aaggagaatccaaatttacttagcggtattcaacaaacaactttgagattacgtgctgca
gagtcggtttgggatgaaaaattagccaaaatccgaaagaaatatgtttttaatcgggat
gaagggataagaatcgatagaaggattctaaaactaccacaaatggaagtgtttttatat
gaatttttgtctgattatggatttaatttagcacaattacaatctttcaaatttcgaaaa
attggtgctcagttatcatctttctctcatactttagttatagataggggttttttacta
gtaaatccaatatctgatgaaattcagaaacagttttttccgatacaaatacaattaaaa
gataagttgattaaaacacctttaggattatttaaatggagttttattaataaaaatgat
gtagattactctattggaaataaaatagtttttattgaagcaaataagctaaaagaacca
atagagttagatttatggaaagaaggagataaaattcaacccattgggatgaaggggaag
aaaaaaataagtgatatattgattgatcaaaaggttcctttgccccaaaagaaaaaggtt
atggttttaaagtcgggtggagaaatcatttgggtgattggacataaattttctgactca
tttaaagttaaaaaagatactacaaaaatattacgaatagaatatgaaaattcttaa

DBGET integrated database retrieval system