KEGG   Marivirga tractuosa: Ftrac_1039Help
Entry
Ftrac_1039        CDS       T01365                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtt  Marivirga tractuosa
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ftrac_1039
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ftrac_1039
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ftrac_1039
Enzymes [BR:mtt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ftrac_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1295314..1296495)
Genome map
AA seq 393 aa AA seqDB search
MEIKIDENGYYGEFGGAYIPELLHPNIEELRNNYLKISAEPAFQEEFKALLKDYVGRPTS
LYLAKRLSEKHGAKIYLKREDLNHTGAHKINNAIGQALLAKRLGKKKIIAETGAGQHGVA
TATACALLDLPCKVFMGEVDMERQKPNVERMRILGAEVIPATSGSRTLKDATNEAMRYWI
NNPDDTHYIIGSVVGPHPFPDMVTRFQSVISEEMMAQLQEQEGTNAPDYVVACVGGGSNA
AGAFYHYLNNEKVKLVAVEAAGHGLDSGETAATTARGSSGVLHGFKTLLMQSEDGQVTEP
YSISAGLDYPGIGPLHAHLYASKRGIFKYVTDKEAMDAGVELSKLEGIIPAVETAHALAA
LDQFEFKKDDIVVINLSGRGDKDLQTYINFGNY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaaatagatgaaaacggatattatggagaatttggaggagcttacattcca
gagcttttgcatccgaatatcgaggagctaagaaataattatttaaaaatatctgcagag
cctgcgtttcaagaagagtttaaagctttgttgaaggactatgtaggtcgaccaacttca
ttatatttggcaaaaagactctctgagaagcatggagctaaaatctatctcaaaagagag
gatttgaaccatacaggagctcataaaatcaacaatgccattgggcaagcattattagca
aaacgattgggtaaaaagaagatcattgccgaaactggtgccggacagcatggtgtggca
actgctacggcttgtgcattgctagacttaccttgtaaagtttttatgggggaagtggat
atggaaagacaaaagcccaatgtagagcgtatgcgtatccttggggcagaagtgattcct
gctacttctgggtccagaactttgaaagatgccacaaacgaagccatgagatattggata
aataacccagatgatacacattatattattggttctgtggtagggccacatccttttcct
gatatggtgacacgtttccagtccgttattagcgaagaaatgatggcgcaattgcaagag
caagaaggcactaacgcaccagattatgtggtggcttgtgtaggtggaggtagtaatgcc
gctggcgctttttaccattacttaaataatgaaaaggtgaaattggttgccgttgaagcg
gccggtcatggtctggatagcggtgaaacggctgctacaactgccagaggtagttctggt
gtactgcatggttttaaaacattactcatgcaatctgaagatggtcaggtaacagagccg
tattcaatttcggcaggcttagactatccgggtatagggccattgcatgctcacttatat
gccagcaaaagagggatctttaaatatgtgaccgacaaagaggctatggatgcgggagtg
gaattaagtaagttggaaggtattattccagctgtggaaactgcccatgctttggctgct
ttagatcaatttgaatttaaaaaagacgatattgtagtgattaatttgtctggaagaggt
gacaaagacttgcagacttacatcaactttggcaattattga

DBGET integrated database retrieval system