KEGG   Marivirga tractuosa: Ftrac_1041Help
Entry
Ftrac_1041        CDS       T01365                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01130  Biosynthesis of antibiotics
mtt01230  Biosynthesis of amino acids
Module
mtt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ftrac_1041
Enzymes [BR:mtt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ftrac_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth ThiG DHO_dh NMO
Motif
Other DBs
NCBI-ProteinID: ADR21038
JGI: Ftrac_1041
UniProt: E4TUB0
Position
complement(1297338..1298159)
Genome map
AA seq 273 aa AA seqDB search
MNILQQIAEYKKAEVAERQKLFPVEFLKQKLYYKSTPVSLKSYVMDETKTGIIAEIKRKS
PSEGKINSHISVEEVSIGYMQSGASALSVLTDQPSFGGSLKDLEVARKFNYCPILRKDFM
LDPYQVYEAKAHGADAILLIAAMIDKSLCQDLAQLAHELGMEVLLEVHNQEELDSHYGNY
ADLVGINSRDLKSFNTDLEVARKLANQLPTDVPKIAESGLKTPEDVVAMKRAGFDGFLIG
TSFMKSSEPGKACQRFSQQVKSLLAEGVAKPTA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaacatattacaacaaatagcagaatataagaaagcagaagtagcagagcgtcaaaag
ctatttccagtggagtttttgaagcaaaagttatactacaaatcaacgccagtcagtttg
aaatcctatgtgatggatgagacgaaaacgggaattatagcggagatcaaaagaaagtcg
ccatcagaaggaaagattaattcacacatttcagtggaggaagtttctattggctatatg
caaagcggagcaagtgcattgtccgttttaacggatcagccttcctttggtggaagtttg
aaagatttggaagtagctagaaaattcaattactgcccgatacttcgaaaagattttatg
ctggatccttatcaagtgtatgaagccaaagcacatggtgcagatgcgatactattgatt
gcggccatgattgataaatccttatgccaggatttagctcaattggcacatgaattagga
atggaggttttattggaagtccataatcaggaagaattagattctcattatggcaattat
gccgatttagtgggaatcaacagtcgagatttgaaaagctttaatactgatttagaagtg
gctaggaaattggcaaaccaacttccaactgatgttcctaaaattgcagaaagtggtttg
aaaacacctgaggatgtggtggccatgaagagagctggatttgatgggtttttaattggg
acttcatttatgaaaagcagtgagccgggtaaagcctgtcagcgattttctcagcaagtg
aaaagcttattggcggaaggagtagctaaaccaactgcttaa

DBGET integrated database retrieval system