KEGG   Marivirga tractuosa: Ftrac_1155Help
Entry
Ftrac_1155        CDS       T01365                                 

Definition
(GenBank) aminopeptidase
Organism
mtt  Marivirga tractuosa
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADR21150
JGI: Ftrac_1155
UniProt: E4TVN7
Position
complement(1426178..1427233)
Genome map
AA seq 351 aa AA seqDB search
MENFNIELLSKICETPGAPGHEKRIRDLVISEVKSLVDEVEVDNLGNVHAIKKAKSNPEG
KKVMVAAHMDEIGFMVTHIDENGFLRFTTLGGFDPKTLTAQRVIVHGKKDVIGVMGSKPI
HVMTTEERNKVSKTTDYFIDLGMKKEEVEKIVSVGDAVTRERGLIEMGDCVNCKSIDNRV
SVFVLIEALKTLRDHPYDVYAVFTVQEEVGLRGANVASHKINPDFGIALDTTIAFDLPGA
QAHEKVTSLGGGTAIKVLDAMTICDYRMVEFMKQTADRNSIKWQPEILTAGGTDTAGLQR
MGKNGAIAGAISIPTRNMHQVIEMAHKQDILDSVQLLNACIETLDKYNWDH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttaatatagaactactttcaaaaatttgtgaaactccaggtgctccgggg
cacgaaaagaggattcgtgacttagtaatcagcgaagtaaaatctttggtagatgaagta
gaggttgataatcttggaaacgtacatgccattaaaaaagctaagagcaatccggaaggc
aaaaaggtaatggtagctgctcatatggatgaaatcggtttcatggtcactcatatagac
gaaaatggcttccttagattcacaacccttggcggttttgatcctaaaacattgaccgct
caacgtgtaattgtacatggtaaaaaagatgtgataggagtgatgggttctaagcctatt
catgtgatgacaacggaggaaagaaataaagtaagtaaaacaaccgactattttattgac
ctaggaatgaagaaggaagaggtagaaaaaatagtatcagttggtgatgcggttacccga
gaaagaggcttaattgagatgggagattgtgttaactgcaaatcaattgataacagagtg
tctgtatttgttttgattgaagctttaaagactttaagagatcacccttatgatgtttat
gctgtatttactgtacaagaggaagtaggacttcgaggtgcaaacgtggcttcccataaa
atcaatcctgatttcggaattgccttagatactaccattgcatttgatttaccaggagcg
caagcccatgaaaaagtgacttctctaggtggaggaaccgcaattaaggttttagatgcc
atgactatttgcgattacagaatggtagaatttatgaagcaaactgctgatagaaattca
atcaaatggcaacctgaaattttaaccgctggaggaacggacaccgcaggcttacaaaga
atgggtaaaaatggggcaatagcaggagcaatttctattcctacaaggaacatgcatcaa
gtaattgaaatggcacacaaacaagatatattggattccgttcaattattgaatgcttgt
atagaaactttagataaatataattgggatcactaa

DBGET integrated database retrieval system