KEGG   Marivirga tractuosa: Ftrac_1423Help
Entry
Ftrac_1423        CDS       T01365                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mtt  Marivirga tractuosa
Brite
Enzymes [BR:mtt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ftrac_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_11 CMAS Methyltransf_32 GCD14 Methyltransf_18 Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: ADR21413
JGI: Ftrac_1423
UniProt: E4TMY2
Position
complement(1729810..1730457)
Genome map
AA seq 215 aa AA seqDB search
MEDSYKHQGMRRKLIQKLRDKGIEDERVLSAMGKIPRHVFFENAFLEHAYQDKAFPIGHG
QTISQPYTVAFQSELLEVKQGDKILEIGTGSGYQACVLCELGARVYTIEYQKDLYERTRR
FLPQMGYKPHFFSGDGSKGILAHAPYDKIIVTAGAPSVPSALLEQLNIGGCLVIPVGDNQ
IQQMLRLTKESEKKIVKEVFSNFSFVPLKGEQGWQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaagacagttataaacatcagggaatgcgcaggaaattgatccagaaactgcgtgat
aaaggcatagaagatgaacgggtattgtcagctatgggaaaaattccacggcatgttttt
tttgaaaatgcgtttttagaacatgcctatcaagataaagcttttccaattgggcatggt
caaaccatttcccagccttatactgtggcatttcaatctgaacttttggaagtaaagcaa
ggagataaaattctggaaatcgggacaggttctggttatcaggcctgtgtgctttgtgaa
ttaggagcaagagtttataccatcgaatatcaaaaggatttatatgagcgcacccgaaga
tttttacctcagatgggttataaaccgcatttctttagtggtgatggctctaaaggaatt
cttgctcatgctccttatgataaaatcattgtaacggctggtgccccaagtgtgccttcc
gctttgcttgagcaattgaatattggaggatgcctcgtaattccagtaggggataatcaa
attcagcagatgcttcgtttaactaaagagtctgaaaagaaaattgtaaaggaagttttc
tcaaattttagttttgtgcctttgaagggtgagcaggggtggcaataa

DBGET integrated database retrieval system