KEGG   Marivirga tractuosa: Ftrac_1591Help
Entry
Ftrac_1591        CDS       T01365                                 

Definition
fad-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mtt  Marivirga tractuosa
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1915397..1916992)
Genome map
AA seq 531 aa AA seqDB search
MKFDYDYIVIGSGFGGSVSALRLSQKGYKVLVVEKGKWYQSKDFAKTNWNLRKWLWLPSL
RFFGIMKLTVFRHVAILSGAGVGGGSLVYANTLPVPKAAFYKTGSWASLRDWETDLKPYY
AIAHKMLGAAENPELFDGDLALQKLAEERNISSQFEATKVAVYFGKPGVEVEDPYFGGKG
PKRTGCTFCGGCMTGCRYDAKNTLDKNYLHLAQQEGAEILAEQEVIDVKPIDNKEGSNGY
HVQLQSSTKFFKTKKSLTANGVIFSGGVMGTVKLLLKLKKKGSLPLLSDKTGEEIRTNNE
TLISVSSLKKNINVSKGVAIGSILHTDENTHLEICRYSEGSGFWKLLHLPMSQGNTIFKR
IGNTFVNMFKSPVRYFRTYWLNSWSKRTVILLFMQSVDSTINFKRGWLGNMVSKVGNGKP
PSPDIPESAQLTKDYAKIINGNATAFSLETLAGIPSTAHILGGAVMGEDAEKGVIDRNNN
VFGYKNMMVIDGSMISANPGVNPSLSITAIAEHAMNQVPEKSSIQADFEKG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgattacgattacattgtaattggcagtgggtttgggggctcggttagtgca
ttaagactttcacaaaaaggatataaggttcttgtggtcgaaaaaggaaagtggtaccag
tcaaaagattttgccaaaaccaactggaatttacgcaagtggttatggttgccatcgctg
cgttttttcggtattatgaagctcacagttttcaggcatgtagccattctctcgggtgct
ggtgtaggaggcggttcccttgtttatgccaatacattacctgtgcctaaagccgccttt
tataaaacgggttcatgggctagtttaagggattgggaaacagacttaaagccctattat
gcaatagcccataaaatgttgggggctgcagaaaacccagagttatttgacggtgatctt
gcccttcaaaagctggctgaagagcgaaatatcagcagtcaatttgaagctactaaagtg
gctgtatattttggtaagccaggggtagaggtagaagacccatactttggtggtaaaggt
cctaaaaggacaggctgcactttttgcgggggctgtatgacgggctgtcgatatgacgca
aagaacacattggataaaaattatttacatcttgcccagcaagaaggcgctgaaatatta
gccgaacaggaagtaattgatgtgaagccaatcgacaataaagaagggtcaaatggttat
catgttcagcttcaatccagtacaaagttttttaaaacaaaaaaatctcttactgcaaat
ggagtgattttctcaggtggggtaatgggtaccgtaaaattattgttaaaactgaagaaa
aaaggctccttgccactcctttctgataaaacgggtgaagaaatacgaaccaataatgaa
acactgatcagcgtatccagtctgaagaaaaatattaatgtgtctaaaggagtggctatc
ggcagtattttgcatactgatgaaaatacacatcttgagatttgtcgctattctgaaggc
tcaggcttttggaagttgctgcatttacccatgtcacaggggaacactatttttaaaagg
ataggaaacacctttgtgaatatgtttaagtcgcctgtccgttatttcagaacctactgg
ctcaacagctggtcaaaacgaacggtgattttgttatttatgcaatctgttgatagcacc
attaactttaaaagaggatggcttggcaatatggtttcgaaagtgggaaatggaaaacca
ccgagtccggacatcccggaatctgctcagttaactaaagattatgcaaaaatcattaat
gggaatgccactgctttctctctggaaacgctggcaggaattccgtcaacagcacatatt
ttgggtggtgctgtgatgggggaagacgctgaaaaaggagtgattgataggaataacaat
gtttttggctataaaaatatgatggtcatagatggctccatgatatcggccaacccggga
gttaacccttcattgtctattaccgctattgcagagcatgcaatgaaccaggtgccggaa
aagtcaagtatacaagctgattttgagaagggataa

DBGET integrated database retrieval system