KEGG   Marivirga tractuosa: Ftrac_1606Help
Entry
Ftrac_1606        CDS       T01365                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mtt  Marivirga tractuosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mtt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1929316..1930290)
Genome map
AA seq 324 aa AA seqDB search
MLIRPRRNRKSAAIREMVEETTLTTKDFIFPLFLLEGKNKKVEVDSMPGIYRFTVDLMLK
EIEECMKLGIKAFDVFPVVEEKHKDKMATKSADESFFYLKALKEIKAKFPEACIMTDVAM
DPYSSDGHDGIVDENGNILNDETLDVLADMALAQAETGIDIIGPSDMMDGRVEYIRDVLD
ENGFENTSIMSYCAKYASAFYGPFRDALDSAPKSGDKKTYQMNPANKYEALIEAELDAQE
GADFLMVKPALAYLDVIHLLKENNELPIAAYNVSGEYSMIKAAAEKGWLNGEATMMESLL
SIKRAGADVILSYFAKEAAQILNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttaatacgcccgagaagaaatcgcaaatcagcagccatccgtgaaatggtggaggaa
accactttaactaccaaagattttatctttcccctttttttattggagggaaaaaataag
aaagtcgaagtagacagcatgcctggcatttatcgattcacagtagatttaatgttaaaa
gaaatcgaggaatgcatgaaattaggcattaaagcttttgatgttttcccagtggtggag
gaaaagcataaagataaaatggctactaaaagtgcagatgagagttttttctatttgaaa
gccttaaaagaaattaaagccaaatttccggaagcttgcatcatgacggatgtagctatg
gatccatacagcagtgacgggcatgatggaatagtagatgaaaacggcaatattctcaat
gatgaaactttggatgttttggctgatatggctttagctcaagcagaaactgggattgat
attattggcccttctgatatgatggatggcagagtggaatatatccgtgatgttttagac
gaaaatggatttgagaatacctccattatgagttattgtgccaaatatgcttctgctttt
tatggtccttttcgcgatgctttggattcagctcctaaatcaggggataaaaaaacctat
cagatgaaccctgccaataaatatgaagctttaattgaggcggagttggatgcccaagaa
ggagctgattttttaatggtgaagcccgctttggcttatttggacgtcattcatttgttg
aaagagaataatgaattgccaattgctgcctataatgtgagtggtgaatatagcatgata
aaagcagctgcagaaaagggctggttaaatggagaagccaccatgatggaaagtttattg
agcatcaaaagagctggagcagatgtgattttaagctattttgctaaagaggcggctcaa
atattgaataaataa

DBGET integrated database retrieval system