KEGG   Marivirga tractuosa: Ftrac_1732Help
Entry
Ftrac_1732        CDS       T01365                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtt  Marivirga tractuosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_1732
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ftrac_1732
  Amino acid metabolism
   00310 Lysine degradation
    Ftrac_1732
Enzymes [BR:mtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ftrac_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2077914..2079509
Genome map
AA seq 531 aa AA seqDB search
MSLEIKVPEVGESITEVTIASWLKKDGDFVEQDEIIAELESDKATFELPAEASGVLTIKA
QEDETIEVGSVICEIDEDAKGGESKSEEKSEDKKEEKSEPKQEKKESSSSNNGPKKTGEV
HEMVVPTVGESITEVTISSWLKSDGDYVEMDEVIAEVESDKATFELPAEANGFLQIVAQE
DDTIEIGATICKIEVTEGGAPSESSPEKSSSESDSSSDSQEEGKETYATGHASPAAAKIL
KEKGIDPSNIKGSGKDGRITKEDAENAEKQSSKAPEKESKSSDSGIETDKLPSPDAGGNR
EQRKEKMSSLRKTVARRLVSVKNETAMLTTFNEVDMKPIMDLRKKYKEQFKEKYEVGLGF
MSFFTKACTMALKEWPAVNAQIDGNEMVYSDFVDMSIAVSSPKGLVVPVIRNAEKLSFHE
IEGEVIRLAKKARDGKLSIDEMSGGTFTITNGGIFGSMLSTPIINAPQSAILGMHNIVER
PVAINGEVQIRPIMYVALSYDHRIIDGKESVSFLVRVKELLEDPTRLLLGI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagaaataaaagtaccggaagtaggcgaatcaatcaccgaagtaaccattgcc
tcatggttaaaaaaagatggcgattttgttgaacaagatgaaatcatcgcagaactggaa
tcagataaagcaacatttgaattgcctgctgaagcttccggtgtattgacaataaaagct
caagaagacgaaaccattgaagttggctcagtcatttgcgaaatagacgaagatgccaaa
ggaggtgaatctaaatcagaagaaaaatctgaggacaagaaagaagaaaaatccgagcca
aaacaggagaagaaagaaagctcttcttcaaacaacggaccaaaaaagactggagaagtt
catgaaatggtagttcctaccgttggtgaatctatcacagaagtgaccataagttcttgg
ttgaaatctgatggcgactatgtggaaatggacgaggttattgcagaagttgaatcagac
aaagcaacttttgaattgcctgcagaggctaatggtttcttacaaatagttgcacaagaa
gacgatactatagagatcggagctacaatctgtaagattgaggttactgaagggggagct
cctagcgaatcttcaccagagaaaagttcttctgaaagtgattcaagctctgattcccaa
gaagaaggaaaagaaacttatgcaacgggacatgcttcaccggccgctgctaagatattg
aaggaaaaaggtattgatccttccaacataaaaggaagcggaaaagatggtagaattaca
aaagaggatgctgaaaatgcagaaaagcaatcatctaaagctccagaaaaagaaagcaaa
tcatctgattcaggaatagaaacagacaaattaccttctccagatgcaggtggaaatcgt
gagcaaagaaaagaaaaaatgtcgagcttgcgtaaaactgttgcccgcagattagtaagc
gtaaaaaatgaaacggctatgttgaccactttcaatgaagtggacatgaagccaatcatg
gatttacgtaaaaaatacaaagagcaatttaaagagaaatatgaagttggattaggcttt
atgtcattcttcacaaaagcttgtacgatggcattgaaagagtggccagccgttaatgct
caaattgatggaaacgaaatggtttacagtgatttcgtagatatgtccattgctgtttcc
tctccaaaaggcttggtagttccagtgataagaaatgctgagaaactatcttttcatgaa
attgaaggtgaagtaatcagattagctaaaaaagctagagatggaaaattgagtatagat
gaaatgagtggaggaacatttactatcaccaatggtggtatatttggatccatgctttct
acaccaataatcaatgcgccacaatcggctattttaggaatgcataatatagtagaaaga
ccagttgccattaacggagaagtacaaatcagaccgattatgtatgtagcccttagctat
gaccacagaattattgacggtaaagaatcagtaagcttcttggtaagagtgaaagagtta
ttggaagatccaactcgtttacttttaggcatataa

DBGET integrated database retrieval system