KEGG   Marivirga tractuosa: Ftrac_1732Help
Entry
Ftrac_1732        CDS       T01365                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mtt  Marivirga tractuosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_1732
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ftrac_1732
  Amino acid metabolism
   00310 Lysine degradation
    Ftrac_1732
Enzymes [BR:mtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ftrac_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2077914..2079509
Genome map
AA seq 531 aa AA seqDB search
MSLEIKVPEVGESITEVTIASWLKKDGDFVEQDEIIAELESDKATFELPAEASGVLTIKA
QEDETIEVGSVICEIDEDAKGGESKSEEKSEDKKEEKSEPKQEKKESSSSNNGPKKTGEV
HEMVVPTVGESITEVTISSWLKSDGDYVEMDEVIAEVESDKATFELPAEANGFLQIVAQE
DDTIEIGATICKIEVTEGGAPSESSPEKSSSESDSSSDSQEEGKETYATGHASPAAAKIL
KEKGIDPSNIKGSGKDGRITKEDAENAEKQSSKAPEKESKSSDSGIETDKLPSPDAGGNR
EQRKEKMSSLRKTVARRLVSVKNETAMLTTFNEVDMKPIMDLRKKYKEQFKEKYEVGLGF
MSFFTKACTMALKEWPAVNAQIDGNEMVYSDFVDMSIAVSSPKGLVVPVIRNAEKLSFHE
IEGEVIRLAKKARDGKLSIDEMSGGTFTITNGGIFGSMLSTPIINAPQSAILGMHNIVER
PVAINGEVQIRPIMYVALSYDHRIIDGKESVSFLVRVKELLEDPTRLLLGI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagaaataaaagtaccggaagtaggcgaatcaatcaccgaagtaaccattgcc
tcatggttaaaaaaagatggcgattttgttgaacaagatgaaatcatcgcagaactggaa
tcagataaagcaacatttgaattgcctgctgaagcttccggtgtattgacaataaaagct
caagaagacgaaaccattgaagttggctcagtcatttgcgaaatagacgaagatgccaaa
ggaggtgaatctaaatcagaagaaaaatctgaggacaagaaagaagaaaaatccgagcca
aaacaggagaagaaagaaagctcttcttcaaacaacggaccaaaaaagactggagaagtt
catgaaatggtagttcctaccgttggtgaatctatcacagaagtgaccataagttcttgg
ttgaaatctgatggcgactatgtggaaatggacgaggttattgcagaagttgaatcagac
aaagcaacttttgaattgcctgcagaggctaatggtttcttacaaatagttgcacaagaa
gacgatactatagagatcggagctacaatctgtaagattgaggttactgaagggggagct
cctagcgaatcttcaccagagaaaagttcttctgaaagtgattcaagctctgattcccaa
gaagaaggaaaagaaacttatgcaacgggacatgcttcaccggccgctgctaagatattg
aaggaaaaaggtattgatccttccaacataaaaggaagcggaaaagatggtagaattaca
aaagaggatgctgaaaatgcagaaaagcaatcatctaaagctccagaaaaagaaagcaaa
tcatctgattcaggaatagaaacagacaaattaccttctccagatgcaggtggaaatcgt
gagcaaagaaaagaaaaaatgtcgagcttgcgtaaaactgttgcccgcagattagtaagc
gtaaaaaatgaaacggctatgttgaccactttcaatgaagtggacatgaagccaatcatg
gatttacgtaaaaaatacaaagagcaatttaaagagaaatatgaagttggattaggcttt
atgtcattcttcacaaaagcttgtacgatggcattgaaagagtggccagccgttaatgct
caaattgatggaaacgaaatggtttacagtgatttcgtagatatgtccattgctgtttcc
tctccaaaaggcttggtagttccagtgataagaaatgctgagaaactatcttttcatgaa
attgaaggtgaagtaatcagattagctaaaaaagctagagatggaaaattgagtatagat
gaaatgagtggaggaacatttactatcaccaatggtggtatatttggatccatgctttct
acaccaataatcaatgcgccacaatcggctattttaggaatgcataatatagtagaaaga
ccagttgccattaacggagaagtacaaatcagaccgattatgtatgtagcccttagctat
gaccacagaattattgacggtaaagaatcagtaagcttcttggtaagagtgaaagagtta
ttggaagatccaactcgtttacttttaggcatataa

DBGET integrated database retrieval system