KEGG   Marivirga tractuosa: Ftrac_1923Help
Entry
Ftrac_1923        CDS       T01365                                 

Definition
acetyl-coenzyme a synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtt  Marivirga tractuosa
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_1923
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_1923
   00620 Pyruvate metabolism
    Ftrac_1923
   00640 Propanoate metabolism
    Ftrac_1923
  Energy metabolism
   00680 Methane metabolism
    Ftrac_1923
Enzymes [BR:mtt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ftrac_1923
Lipid biosynthesis proteins [BR:mtt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ftrac_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2310210..2312105
Genome map
AA seq 631 aa AA seqDB search
MSDRIHTLSGYIHEYQRSVHQPEQFWSRIADSFHWKKRWEKIVEWNFEEPKIEWFKGAKL
NITENILEKHLFTMGDKPAIIWEPNEPGDENQTITFRQLYEKVNQFANAMKAKGIKKGDR
VIIYMPMVPEAAIAMLACARIGAVHSVVFAGFSSNALADRINDCQAKMVLTSDGNFRGAK
SIPVKAVVDEALVKTKTIENVIVFKRTGEGVEMKAGRDIWWEDAIKGQSTECSAEVMDAE
DMLFILYTSGSTGKPKGVVHTCGGYMVYTKYSFENVFQYDQGDVYWCTADVGWITGHSYI
VYGPLLAGATTVMFEGVPTYPDAGRFWDVVDKYKVNQFYTAPTAIRALQAYGTEPVDKRD
LSSLKVLGTVGEPINEEAWHWYHSHVGKGKCPVVDTWWQTETGGIMISPLAGITPTKPSY
ATLPLPGIQPVIVDADGNELKGNSVEGNLCMKFPWPGMLRTTYGDHERCKNTYFATYKNM
YFTGDGVKRDEDGYYRILGRVDDVINVSGHRMGTAEVENAINEHPKVIESAVVGYPHEVK
GQGIYAYVICDLENRTEENLINEISETVRNIIGAIAKPDKIQVVSGLPKTRSGKIMRRIL
RKIAEGDTSNLGDTSTLLNPEIVDEIKAGAK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatagaattcatacccttagtgggtacatacacgaataccaaagaagtgtgcac
caaccagagcagttttggtcgagaattgccgattcgtttcactggaaaaaaagatgggaa
aagatagtggaatggaattttgaggaaccaaaaattgaatggtttaaaggtgccaaactg
aatatcacagaaaacatcttggaaaaacatctctttacgatgggcgataaacctgctatc
atttgggaacccaatgaacctggtgatgaaaatcaaaccatcaccttccgacagctctac
gaaaaagtaaaccaatttgccaatgccatgaaagcaaaaggcatcaaaaaaggcgataga
gtcattatttatatgccaatggtgccagaagcagccattgccatgctagcttgcgctaga
attggagcagtccattccgtggtttttgcaggcttttcctcaaatgcattagctgatcga
attaatgactgtcaagctaaaatggtcttgacttcagatggaaatttcagaggtgcaaaa
tcaattcctgtgaaagcagtggtggatgaagctttagtaaagaccaaaaccatagaaaat
gtcatcgtttttaaaagaactggtgaaggggttgaaatgaaagcgggaagagatatttgg
tgggaagatgccattaaaggtcaatcaaccgaatgctcggcagaagtaatggacgctgaa
gatatgctattcattctctacacttcaggatcaacaggaaaaccaaaaggtgtggtgcat
acttgtggtggttacatggtatataccaaatattcctttgaaaatgtatttcaatacgac
caaggcgatgtgtattggtgtaccgctgatgtaggctggattaccggtcattcctacatt
gtgtatggcccacttttagcgggagccaccacggtgatgtttgaaggtgttcctacctat
cctgatgctggtcgcttttgggatgtggtggataaatataaagtaaatcaattttacaca
gcccctactgcaatacgagctttgcaggcttacggcacggagccagttgacaaaagagat
ttaagctcgttaaaagtattaggaacggtgggtgagcctatcaatgaagaggcttggcat
tggtatcattcccatgtggggaaaggcaaatgccctgtagtagatacttggtggcaaaca
gaaactggtggcatcatgatttctcctttagctggaattacgcctacaaaaccttcttat
gctaccctcccacttccaggtattcagcctgtgattgtagatgcggatgggaatgaacta
aaaggaaattcagtagaaggaaatctatgtatgaaatttccatggccaggcatgctgaga
accacttatggcgaccatgaaagatgcaaaaatacatatttcgctacttataaaaatatg
tatttcactggtgatggagtcaaacgggatgaagacggttattacagaattttaggtaga
gtagatgatgtaatcaatgtttccggacatagaatgggaactgctgaggtggagaacgcc
attaacgagcaccctaaagtaattgaatcagcagtagttggttatccgcatgaagtaaaa
ggacagggcatttatgcttatgtgatttgtgatttagaaaacagaacagaagaaaaccta
atcaatgaaataagtgaaacagttcgaaacataatcggagctattgctaaaccagataag
attcaggtggtttccggattgcctaaaacacgatctggtaaaattatgcgtagaatatta
agaaaaattgctgaaggggacacaagtaatttgggtgatacttctacattattaaaccct
gaaatagtggatgagataaaagcaggagctaaataa

DBGET integrated database retrieval system