KEGG   Marivirga tractuosa: Ftrac_1923Help
Entry
Ftrac_1923        CDS       T01365                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00010  Glycolysis / Gluconeogenesis
mtt00620  Pyruvate metabolism
mtt00640  Propanoate metabolism
mtt00680  Methane metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01130  Biosynthesis of antibiotics
mtt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_1923
   00620 Pyruvate metabolism
    Ftrac_1923
   00640 Propanoate metabolism
    Ftrac_1923
  Energy metabolism
   00680 Methane metabolism
    Ftrac_1923
Enzymes [BR:mtt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ftrac_1923
Lipid biosynthesis proteins [BR:mtt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ftrac_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADR21908
JGI: Ftrac_1923
UniProt: E4TT78
Position
2310210..2312105
Genome map
AA seq 631 aa AA seqDB search
MSDRIHTLSGYIHEYQRSVHQPEQFWSRIADSFHWKKRWEKIVEWNFEEPKIEWFKGAKL
NITENILEKHLFTMGDKPAIIWEPNEPGDENQTITFRQLYEKVNQFANAMKAKGIKKGDR
VIIYMPMVPEAAIAMLACARIGAVHSVVFAGFSSNALADRINDCQAKMVLTSDGNFRGAK
SIPVKAVVDEALVKTKTIENVIVFKRTGEGVEMKAGRDIWWEDAIKGQSTECSAEVMDAE
DMLFILYTSGSTGKPKGVVHTCGGYMVYTKYSFENVFQYDQGDVYWCTADVGWITGHSYI
VYGPLLAGATTVMFEGVPTYPDAGRFWDVVDKYKVNQFYTAPTAIRALQAYGTEPVDKRD
LSSLKVLGTVGEPINEEAWHWYHSHVGKGKCPVVDTWWQTETGGIMISPLAGITPTKPSY
ATLPLPGIQPVIVDADGNELKGNSVEGNLCMKFPWPGMLRTTYGDHERCKNTYFATYKNM
YFTGDGVKRDEDGYYRILGRVDDVINVSGHRMGTAEVENAINEHPKVIESAVVGYPHEVK
GQGIYAYVICDLENRTEENLINEISETVRNIIGAIAKPDKIQVVSGLPKTRSGKIMRRIL
RKIAEGDTSNLGDTSTLLNPEIVDEIKAGAK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatagaattcatacccttagtgggtacatacacgaataccaaagaagtgtgcac
caaccagagcagttttggtcgagaattgccgattcgtttcactggaaaaaaagatgggaa
aagatagtggaatggaattttgaggaaccaaaaattgaatggtttaaaggtgccaaactg
aatatcacagaaaacatcttggaaaaacatctctttacgatgggcgataaacctgctatc
atttgggaacccaatgaacctggtgatgaaaatcaaaccatcaccttccgacagctctac
gaaaaagtaaaccaatttgccaatgccatgaaagcaaaaggcatcaaaaaaggcgataga
gtcattatttatatgccaatggtgccagaagcagccattgccatgctagcttgcgctaga
attggagcagtccattccgtggtttttgcaggcttttcctcaaatgcattagctgatcga
attaatgactgtcaagctaaaatggtcttgacttcagatggaaatttcagaggtgcaaaa
tcaattcctgtgaaagcagtggtggatgaagctttagtaaagaccaaaaccatagaaaat
gtcatcgtttttaaaagaactggtgaaggggttgaaatgaaagcgggaagagatatttgg
tgggaagatgccattaaaggtcaatcaaccgaatgctcggcagaagtaatggacgctgaa
gatatgctattcattctctacacttcaggatcaacaggaaaaccaaaaggtgtggtgcat
acttgtggtggttacatggtatataccaaatattcctttgaaaatgtatttcaatacgac
caaggcgatgtgtattggtgtaccgctgatgtaggctggattaccggtcattcctacatt
gtgtatggcccacttttagcgggagccaccacggtgatgtttgaaggtgttcctacctat
cctgatgctggtcgcttttgggatgtggtggataaatataaagtaaatcaattttacaca
gcccctactgcaatacgagctttgcaggcttacggcacggagccagttgacaaaagagat
ttaagctcgttaaaagtattaggaacggtgggtgagcctatcaatgaagaggcttggcat
tggtatcattcccatgtggggaaaggcaaatgccctgtagtagatacttggtggcaaaca
gaaactggtggcatcatgatttctcctttagctggaattacgcctacaaaaccttcttat
gctaccctcccacttccaggtattcagcctgtgattgtagatgcggatgggaatgaacta
aaaggaaattcagtagaaggaaatctatgtatgaaatttccatggccaggcatgctgaga
accacttatggcgaccatgaaagatgcaaaaatacatatttcgctacttataaaaatatg
tatttcactggtgatggagtcaaacgggatgaagacggttattacagaattttaggtaga
gtagatgatgtaatcaatgtttccggacatagaatgggaactgctgaggtggagaacgcc
attaacgagcaccctaaagtaattgaatcagcagtagttggttatccgcatgaagtaaaa
ggacagggcatttatgcttatgtgatttgtgatttagaaaacagaacagaagaaaaccta
atcaatgaaataagtgaaacagttcgaaacataatcggagctattgctaaaccagataag
attcaggtggtttccggattgcctaaaacacgatctggtaaaattatgcgtagaatatta
agaaaaattgctgaaggggacacaagtaatttgggtgatacttctacattattaaaccct
gaaatagtggatgagataaaagcaggagctaaataa

DBGET integrated database retrieval system