KEGG   Marivirga tractuosa: Ftrac_2071Help
Entry
Ftrac_2071        CDS       T01365                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mtt  Marivirga tractuosa
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mtt00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2456809..2458329)
Genome map
AA seq 506 aa AA seqDB search
MEAKDTRHNVLKLVRLGIDARNEYMVFMRKDCPVCISEGFEALNRIKVTKGEKTIVASLI
VWDDESQLSHDQLGLSDAAIEALETKEGDLLRLSHLDALDSMSDVRKKIYGHRLNQAEFD
RIIGDIVNRNLSNIQLSAFLASSTGNSLNQDEVIALTRSMINVGFKLDWGKDKVYDKHCI
GGLPGNRTTPLVVSIVAAAGLTIPKTSSRAITSPAGTADTMEVVTNVNLTTGQMKNVVEQ
EGGCLAWGGSVQLSPADDILIRVEKALDIDSEGQMIASVLSKKAAAGSTDVVIDIPVGAT
AKVRSQEAAVHLSEKMVAVGKAIGLNIDIVLTDGSQPVGRGIGPALEAKDVLSVLRNENN
APDDLRERAIILAGRLLEMGGKAAEGSGTLEALRVLKSGAAYKKFTAICEAQGFFREPEV
APHKHRIRSAASGVVSEIDNRRLAKVAKLAGAPGAMTAGILLLTPLGTHVEENDTLFEIH
AESQGELEYALSYLDAQKQIIKIKAT
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaggatacccgacataacgtattaaaactagtaagactaggcatagatgcc
cgcaatgaatatatggtatttatgcgtaaggactgcccggtttgtatatcggaagggttt
gaggctttaaatcgtataaaagttacaaaaggagaaaaaaccattgtagcatctcttatc
gtttgggatgatgagtcacaattaagtcatgaccaattgggcctttctgatgccgctatt
gaagccttggaaactaaagaaggtgacttacttaggctgagccatttagatgcgcttgat
tccatgagtgatgtccgtaagaaaatttatggacaccgactgaaccaagccgagtttgac
aggataatcggagatattgtcaatcggaatctatccaatatccaactatccgcctttctg
gcttccagcactggaaactcattaaatcaggacgaagtgattgccctgacccgttccatg
attaacgtgggttttaaactggactggggcaaggataaagtttatgataaacactgcatc
ggtggcttgcctggtaacagaactactccattggtagtgtctattgttgccgcagctggg
ttgaccatccctaaaacttcttcccgtgccattacttctcctgccggtactgctgacacc
atggaggtagtcaccaacgtaaatctcaccaccgggcaaatgaaaaatgtcgtggaacag
gaaggcggttgccttgcctggggcggatcagtacagctaagtccggcagatgatatactc
atccgtgtagaaaaagctttggatattgatagcgaagggcagatgatcgcttccgtgctt
tctaaaaaggcggcagcaggttctaccgatgtggtgattgatattcctgttggagctacg
gctaaggtgcggtcgcaggaggctgctgtgcatctgtcagaaaagatggttgcggtaggc
aaagccatcgggctgaatattgatattgtattaaccgatgggtcacaacctgtggggagg
ggtatagggcctgccttggaagctaaggatgttttatccgtcttgagaaatgaaaacaat
gcacctgatgacctgcgagaaagagcaataatattggcaggcaggttacttgaaatggga
ggaaaagcagccgaagggtcaggtactcttgaagctttgagagttttgaaaagtggagcc
gcctacaaaaaattcactgctatctgcgaggcacaaggttttttcagggaacctgaggta
gcgccccataagcataggattagatccgcagcaagtggagtagtttcagaaattgataat
cgcagactggccaaagtggctaagctggccggtgctccaggtgcgatgacagcaggcatt
ttgctgcttacaccattgggtactcatgtggaagagaacgatactctgtttgaaatccat
gctgagtcacaaggagagcttgaatacgccctttcttacctggatgcacaaaaacaaatt
attaaaatcaaagcgacttaa

DBGET integrated database retrieval system