KEGG   Marivirga tractuosa: Ftrac_2304Help
Entry
Ftrac_2304        CDS       T01365                                 

Definition
delta-9 acyl-phospholipid desaturase (EC:1.14.19.1 1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mtt  Marivirga tractuosa
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ftrac_2304
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ftrac_2304
Enzymes [BR:mtt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Ftrac_2304
Lipid biosynthesis proteins [BR:mtt01004]
 Desaturase
  First
   Ftrac_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2722803..2723735
Genome map
AA seq 310 aa AA seqDB search
MAVAVKENLKIRKKGTWKKEISFAIVHLLPLGAIWTGATWFDWTVCAFLYVWRMFWVTGG
YHRYFAHRSYNTSRWFQFLIAFFAQTSAQKGALWWASHHRHHHRNSDTLKDPHSMLHFGF
WYSHVGWIIGSDFKKTDFKVISDYSKYPELRWLNKNYLVPPVILALTVMALGGLVNGGTI
LAMFTTAGFSTLFIGFFLSTIILYHATFSINSIMHKFGNQRYETGDESRNSVWLALLTLG
EGWHNNHHYYETSARQGFFWWEVDLTYYGLKFMSMLGLIWDLKPVPKHIKKSRNKQEAKE
LKEQFKKQVA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgcagtaaaagaaaacctaaagattcgaaaaaaagggacctggaaaaaagaa
attagttttgctatcgtacatttattgcccttaggcgcaatttggactggtgctacttgg
ttcgattggacagtctgtgctttcctctatgtttggagaatgttttgggttacgggtggt
taccaccgatatttcgcccacagaagctacaatacttctcgttggttccagtttttgata
gctttttttgcgcaaacatcagcacaaaaaggtgctttatggtgggcttctcatcatcgt
caccatcacagaaacagtgacaccttaaaagatccacatagcatgttgcattttggattt
tggtattctcacgttggctggattattggttctgattttaaaaaaactgattttaaagta
atctctgattatagtaagtatccagaattaagatggttgaataaaaattatttagttcca
cccgttattctggcattaaccgttatggcactaggaggtttggtaaatggtggtactatt
ctagccatgtttacaactgcaggattctcaacgctattcattggcttctttttaagtaca
atcattttgtatcatgccactttttccattaacagtatcatgcacaaatttggtaaccag
cgatatgaaactggagatgaatccagaaatagtgtctggttagctttattaactttaggc
gaaggttggcacaataatcaccactattatgaaacatcagccagacaggggttcttttgg
tgggaagtagatctaacgtattacggattaaagtttatgtcaatgctaggcttgatttgg
gatcttaagccagtgccgaaacacattaaaaagtcacggaataaacaggaagcaaaagag
ctgaaagagcaatttaaaaaacaagtagcataa

DBGET integrated database retrieval system