KEGG   Marivirga tractuosa: Ftrac_2600Help
Entry
Ftrac_2600        CDS       T01365                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtt  Marivirga tractuosa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_2600
   01230 Biosynthesis of amino acids
    Ftrac_2600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_2600
   00051 Fructose and mannose metabolism
    Ftrac_2600
   00562 Inositol phosphate metabolism
    Ftrac_2600
Enzymes [BR:mtt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ftrac_2600
Exosome [BR:mtt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ftrac_2600
  Exosomal proteins of bladder cancer cells
   Ftrac_2600
  Exosomal proteins of melanoma cells
   Ftrac_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3068420..3069181
Genome map
AA seq 253 aa AA seqDB search
MRQKIVAGNWKMNKTLVEAQSLTSEIANMVEDEAPSDVKVVIAPPAPFIYAVENLIPEMG
QIVLAGQNCHQEDAGAFTGEVSAPMLKSLGAQYVILGHSERREHFSETDEELAKKTDNAL
KNDLKVIFCCGEPLEIREADTQNEYVTKQLTNSLFHLTPEQFKNIVIAYEPIWAIGTGKT
ASSQQAQDMHKTIREHIAAKFGQDAANKTSILYGGSCKPDNAKELFSQPDVDGGLIGGAS
LKSRDFTDIIKSF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagacagaaaatagtagcaggaaactggaaaatgaataaaactttagtggaagcacaa
tccttaacttctgaaattgccaatatggtcgaagatgaggctccttcggatgtgaaagtg
gtgattgctcctccagcgcctttcatatatgcagtagaaaatttaattcctgaaatggga
cagatcgttttggctggtcagaattgtcatcaagaagatgctggtgcttttacaggtgaa
gtttcggctcctatgttaaaatctttaggtgctcaatatgtgattttagggcatagcgaa
agaagagaacatttctctgaaaccgatgaagaattagccaaaaagactgataatgctttg
aaaaatgacttgaaggtaattttttgttgtggtgagcctcttgaaattagagaggcggat
actcaaaatgaatatgtgaccaagcaattgaccaacagcttatttcatttaacccctgag
caatttaaaaatatcgtaattgcttacgaaccaatttgggcaattggaacgggtaaaaca
gctagttctcaacaagctcaagatatgcataaaaccattcgtgagcatattgctgcaaaa
tttggacaagatgctgcaaataaaacgtctattttatatggcggaagttgtaaacctgat
aatgcgaaagagcttttttctcaaccggatgttgatggaggtttaattggaggggcatct
ctgaaatcaagagattttactgatataatcaagtctttttaa

DBGET integrated database retrieval system