KEGG   Marivirga tractuosa: Ftrac_2600Help
Entry
Ftrac_2600        CDS       T01365                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00010  Glycolysis / Gluconeogenesis
mtt00051  Fructose and mannose metabolism
mtt00562  Inositol phosphate metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01130  Biosynthesis of antibiotics
mtt01200  Carbon metabolism
mtt01230  Biosynthesis of amino acids
Module
mtt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtt_M00002  Glycolysis, core module involving three-carbon compounds
mtt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_2600
   00051 Fructose and mannose metabolism
    Ftrac_2600
   00562 Inositol phosphate metabolism
    Ftrac_2600
Enzymes [BR:mtt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ftrac_2600
Exosome [BR:mtt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ftrac_2600
  Exosomal proteins of bladder cancer cells
   Ftrac_2600
  Exosomal proteins of melanoma cells
   Ftrac_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF1611
Motif
Other DBs
NCBI-ProteinID: ADR22578
JGI: Ftrac_2600
UniProt: E4TPL4
Position
3068420..3069181
Genome map
AA seq 253 aa AA seqDB search
MRQKIVAGNWKMNKTLVEAQSLTSEIANMVEDEAPSDVKVVIAPPAPFIYAVENLIPEMG
QIVLAGQNCHQEDAGAFTGEVSAPMLKSLGAQYVILGHSERREHFSETDEELAKKTDNAL
KNDLKVIFCCGEPLEIREADTQNEYVTKQLTNSLFHLTPEQFKNIVIAYEPIWAIGTGKT
ASSQQAQDMHKTIREHIAAKFGQDAANKTSILYGGSCKPDNAKELFSQPDVDGGLIGGAS
LKSRDFTDIIKSF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagacagaaaatagtagcaggaaactggaaaatgaataaaactttagtggaagcacaa
tccttaacttctgaaattgccaatatggtcgaagatgaggctccttcggatgtgaaagtg
gtgattgctcctccagcgcctttcatatatgcagtagaaaatttaattcctgaaatggga
cagatcgttttggctggtcagaattgtcatcaagaagatgctggtgcttttacaggtgaa
gtttcggctcctatgttaaaatctttaggtgctcaatatgtgattttagggcatagcgaa
agaagagaacatttctctgaaaccgatgaagaattagccaaaaagactgataatgctttg
aaaaatgacttgaaggtaattttttgttgtggtgagcctcttgaaattagagaggcggat
actcaaaatgaatatgtgaccaagcaattgaccaacagcttatttcatttaacccctgag
caatttaaaaatatcgtaattgcttacgaaccaatttgggcaattggaacgggtaaaaca
gctagttctcaacaagctcaagatatgcataaaaccattcgtgagcatattgctgcaaaa
tttggacaagatgctgcaaataaaacgtctattttatatggcggaagttgtaaacctgat
aatgcgaaagagcttttttctcaaccggatgttgatggaggtttaattggaggggcatct
ctgaaatcaagagattttactgatataatcaagtctttttaa

DBGET integrated database retrieval system