KEGG   Marivirga tractuosa: Ftrac_2600Help
Entry
Ftrac_2600        CDS       T01365                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtt  Marivirga tractuosa
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_2600
   01230 Biosynthesis of amino acids
    Ftrac_2600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_2600
   00051 Fructose and mannose metabolism
    Ftrac_2600
   00562 Inositol phosphate metabolism
    Ftrac_2600
Enzymes [BR:mtt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ftrac_2600
Exosome [BR:mtt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ftrac_2600
  Exosomal proteins of bladder cancer cells
   Ftrac_2600
  Exosomal proteins of melanoma cells
   Ftrac_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3068420..3069181
Genome map
AA seq 253 aa AA seqDB search
MRQKIVAGNWKMNKTLVEAQSLTSEIANMVEDEAPSDVKVVIAPPAPFIYAVENLIPEMG
QIVLAGQNCHQEDAGAFTGEVSAPMLKSLGAQYVILGHSERREHFSETDEELAKKTDNAL
KNDLKVIFCCGEPLEIREADTQNEYVTKQLTNSLFHLTPEQFKNIVIAYEPIWAIGTGKT
ASSQQAQDMHKTIREHIAAKFGQDAANKTSILYGGSCKPDNAKELFSQPDVDGGLIGGAS
LKSRDFTDIIKSF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagacagaaaatagtagcaggaaactggaaaatgaataaaactttagtggaagcacaa
tccttaacttctgaaattgccaatatggtcgaagatgaggctccttcggatgtgaaagtg
gtgattgctcctccagcgcctttcatatatgcagtagaaaatttaattcctgaaatggga
cagatcgttttggctggtcagaattgtcatcaagaagatgctggtgcttttacaggtgaa
gtttcggctcctatgttaaaatctttaggtgctcaatatgtgattttagggcatagcgaa
agaagagaacatttctctgaaaccgatgaagaattagccaaaaagactgataatgctttg
aaaaatgacttgaaggtaattttttgttgtggtgagcctcttgaaattagagaggcggat
actcaaaatgaatatgtgaccaagcaattgaccaacagcttatttcatttaacccctgag
caatttaaaaatatcgtaattgcttacgaaccaatttgggcaattggaacgggtaaaaca
gctagttctcaacaagctcaagatatgcataaaaccattcgtgagcatattgctgcaaaa
tttggacaagatgctgcaaataaaacgtctattttatatggcggaagttgtaaacctgat
aatgcgaaagagcttttttctcaaccggatgttgatggaggtttaattggaggggcatct
ctgaaatcaagagattttactgatataatcaagtctttttaa

DBGET integrated database retrieval system