KEGG   Marivirga tractuosa: Ftrac_2708Help
Entry
Ftrac_2708        CDS       T01365                                 

Definition
nitrous oxide reductase apoprotein (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
mtt  Marivirga tractuosa
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Ftrac_2708
Enzymes [BR:mtt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Ftrac_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3194658..3196685
Genome map
AA seq 675 aa AA seqDB search
MKTHYLNYVAGLSLIFLMASCGNQGSETSQVLGGSAAEQAYVAPGEYDEFYAFMSGGYSG
QITAYGLPSGRLLKEIPVFSKYPENGYGYSEETKAMFNTSYGEVPWDDSHHIELSQTDGE
FDGRWLFVNGNNTPRIARVDLKTFETVEILEIPDVAGLHCAPFITENSEYLVSGTRFSVP
IPQKDVPIDTYKKNFKGLINYVSVDPEHGHMELAFQIEMPGFNYDLARNGKGKSHGWSFL
TTYNSEQEHSLLEVNASQKDKDLMAVINWKKAEQYMKEGKFTERETSYFHNLMNEETSIA
ESEEKTLTKILDPKECPDMVYFIPVPKSPHGCDVDPTGEYIVGNGKLSADMSVYSFDKIM
KAIEEKNFDGEFDGIPIISYEAALDGIVKKPGLGPLHTEFDGRGNAYTTFFISSEVVKWD
VASKEILDRQSTFYSPGHLVIPGGETKKPDGKYLVAMNKITKDRYLPTGPELAHSAQLFD
ISGDKMKLILDFPTKGEPHYAQAIAADKIQPNSVKFYDIEKNKHPYATLGESKTRVERDG
DEVHVYMTAIRSHLAPDNIEGFKVGDKVYFHLTNLEQDWDVPHGFAIQGATNAELLVMPG
QTRTLLWEPKRPGVFAFYCTDFCSALHQEMSGYARVSPKGSNVPLKWGLNEKLRENEQAA
HDFYEKAKQNANIGK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacattatttaaattatgttgcaggattaagtctgatttttttaatggcttcc
tgtggcaatcaaggttcagaaacctcccaagttttgggaggtagcgcagcggagcaggct
tatgttgctcccggtgagtatgatgagttttatgcttttatgtctggtggttatagtgga
caaatcactgcctacggattaccttcaggaagattattaaaggaaattcctgttttttca
aaatatcctgaaaatggatatggctacagtgaagaaaccaaggccatgttcaatacttct
tatggagaagtgccttgggatgattctcaccatattgaactttcccaaacagatggcgag
tttgatggccgatggttattcgtaaatggtaacaacactcctagaattgccagagtggat
ttaaaaacattcgaaacagttgaaatcttggaaattcctgatgtggcgggtttgcactgt
gcgccttttataaccgaaaattctgaatacctagtttcaggtactcgtttttctgtccct
atccctcaaaaagatgtgcctatcgatacttacaaaaagaatttcaaaggcttaatcaat
tatgtttcggttgatcctgaacatggtcacatggaattagccttccaaattgaaatgcca
ggctttaattatgatttagctagaaatgggaaaggaaaatctcacggatggagcttttta
actacctacaattctgagcaagagcacagtcttttggaggtaaacgcatcccaaaaagat
aaagatttgatggcggtgatcaactggaaaaaagctgagcaatacatgaaagaagggaaa
tttacagaaagagaaacttcctatttccataatttaatgaatgaagaaactagcattgcg
gaatcagaagaaaaaaccttaactaaaatattggatcctaaagaatgtccagatatggtt
tatttcattccggttccaaaatcacctcatggttgcgatgttgatccaactggtgaatac
attgtagggaacggaaagctttctgctgatatgtctgtttactcatttgacaaaatcatg
aaagcaattgaagagaaaaactttgatggtgaatttgatggaattccaattattagctat
gaagctgctctagatggcattgttaaaaaaccgggcttaggaccattgcacacagaattt
gatggaagaggaaatgcttatactactttctttatatcatctgaagtagtgaaatgggat
gtagcatctaaagaaattttagatcgtcaatcaaccttctattctcctggtcacttagta
attcctggtggagaaactaaaaaaccagatggcaagtatttagtggcaatgaataaaatc
actaaagatcgttatttaccaacaggtcctgaattggcacactctgctcaattatttgac
atcagcggtgataaaatgaaattgattttagatttcccaaccaaaggagaaccgcattat
gcgcaagctattgctgcagataaaattcagcctaattctgtcaaattctatgatattgag
aaaaataagcacccttatgctaccttaggtgaaagtaaaactagagtagagcgtgatggc
gatgaagtgcatgtttatatgactgcaattagaagccacttggctcctgataatattgaa
ggatttaaagtaggagataaagtatatttccacctaaccaatttagaacaggattgggat
gtgccacacggatttgcaattcaaggggctactaatgctgaattgttagtaatgcctggg
caaactagaaccttactttgggaacctaaaagaccaggagtatttgcattctactgtact
gatttctgttccgcgcttcaccaagaaatgtctggttatgctagagtttctcctaaaggc
tcaaatgttcctttaaaatggggattaaatgagaaattgagagagaatgaacaggctgct
catgatttctatgagaaagctaaacaaaatgccaatattggtaaataa

DBGET integrated database retrieval system