KEGG   Marivirga tractuosa: Ftrac_2864Help
Entry
Ftrac_2864        CDS       T01365                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00260  Glycine, serine and threonine metabolism
mtt00750  Vitamin B6 metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01230  Biosynthesis of amino acids
Module
mtt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ftrac_2864
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ftrac_2864
Enzymes [BR:mtt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ftrac_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADR22841
JGI: Ftrac_2864
UniProt: E4TSC4
Position
3368643..3369920
Genome map
AA seq 425 aa AA seqDB search
MNYYSAKNKRLRKPFREAVIEGLPSDNGLFMPERITQLPNGYFGNIVDKTIQEVAFDVLK
PFVEDDLNEQQLQSIIQKTFSFDFPLRKIKGNHYALELFHGPSYAFKDIGATFLALCLEE
FYKDQQEKCTILVATSGDTGGAVAAAFSKVKNIEVVILYPSGKVSELQERQLTTFDENVK
ALEIEGDFDDCQQLVKQAFLDADLRKRLNISSANSINVARFLPQMVYYFAPFIEFGKEPL
TIAVPSGNYGNLTAGLIAQKMGLPVEQFIAGANRNDVVPRYLNSGKYEPQETIQTISNAM
DVGNPSNFQRMMDLFSEKEIKEIVKGFAFSDEDTLELMKKVYIESDYLLDPHGAVGYLAL
VEQMKTSKGKGIVLETAHPCKFMDVIKKVADENILPDSAQALMQKEKKSVKMEVDYEVFK
DYLLQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaactactacagcgctaaaaataaaaggttaagaaagccttttcgggaagcagttata
gaaggattgccttctgataacggcttatttatgccagagaggattactcaattgcctaat
ggatattttggaaatatagtggataagactattcaagaggttgcttttgatgttttaaaa
ccatttgtggaagatgatctgaatgagcagcaattacagtctatcattcaaaaaaccttt
tcatttgattttccactcagaaaaatcaagggcaatcattatgcattagaattattccat
ggaccaagttacgcgtttaaagatataggagctacatttttggctttgtgcctagaagag
ttttacaaagatcagcaagaaaaatgtacgatcttggtagccacctctggagatactggt
ggtgcagtggctgcagctttttcaaaggtgaaaaatattgaggttgtgattctctatcct
tcaggaaaggtaagtgaattgcaggaaaggcagctgacaacttttgatgaaaatgtaaag
gcattagaaattgaaggtgatttcgatgattgtcagcaattagtgaaacaagcatttctg
gatgctgatttgagaaaacggctgaatataagctctgccaattcgattaatgttgcccgt
tttttacctcaaatggtctattattttgctccttttattgaatttggcaaagaacctcta
acgatagctgttccaagtggaaattatggcaacctgactgctggattgattgcacaaaaa
atgggcttaccagtagaacaatttattgctggggcaaataggaatgatgtcgttcctaga
tatttgaatagtggcaaatatgaaccacaagaaactattcaaacgatctcaaatgcgatg
gatgtaggtaatccaagcaacttccagcgaatgatggatttgttttcggagaaagaaatc
aaggaaatagtaaaagggtttgccttttcagatgaggatactttagagttgatgaaaaaa
gtatatatagaaagtgactatttattagatcctcatggagcagttggctatttagcctta
gtagaacagatgaaaacttcaaagggtaaaggaattgtacttgagacagctcatccatgt
aaatttatggatgtgatcaagaaagtagcggatgaaaatattttgcccgattcagcccaa
gctctaatgcagaaggaaaagaagagtgtgaagatggaagtggattatgaagtatttaag
gattatttactgcagtaa

DBGET integrated database retrieval system