KEGG   Marivirga tractuosa: Ftrac_2864Help
Entry
Ftrac_2864        CDS       T01365                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtt  Marivirga tractuosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ftrac_2864
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ftrac_2864
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ftrac_2864
Enzymes [BR:mtt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ftrac_2864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3368643..3369920
Genome map
AA seq 425 aa AA seqDB search
MNYYSAKNKRLRKPFREAVIEGLPSDNGLFMPERITQLPNGYFGNIVDKTIQEVAFDVLK
PFVEDDLNEQQLQSIIQKTFSFDFPLRKIKGNHYALELFHGPSYAFKDIGATFLALCLEE
FYKDQQEKCTILVATSGDTGGAVAAAFSKVKNIEVVILYPSGKVSELQERQLTTFDENVK
ALEIEGDFDDCQQLVKQAFLDADLRKRLNISSANSINVARFLPQMVYYFAPFIEFGKEPL
TIAVPSGNYGNLTAGLIAQKMGLPVEQFIAGANRNDVVPRYLNSGKYEPQETIQTISNAM
DVGNPSNFQRMMDLFSEKEIKEIVKGFAFSDEDTLELMKKVYIESDYLLDPHGAVGYLAL
VEQMKTSKGKGIVLETAHPCKFMDVIKKVADENILPDSAQALMQKEKKSVKMEVDYEVFK
DYLLQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaactactacagcgctaaaaataaaaggttaagaaagccttttcgggaagcagttata
gaaggattgccttctgataacggcttatttatgccagagaggattactcaattgcctaat
ggatattttggaaatatagtggataagactattcaagaggttgcttttgatgttttaaaa
ccatttgtggaagatgatctgaatgagcagcaattacagtctatcattcaaaaaaccttt
tcatttgattttccactcagaaaaatcaagggcaatcattatgcattagaattattccat
ggaccaagttacgcgtttaaagatataggagctacatttttggctttgtgcctagaagag
ttttacaaagatcagcaagaaaaatgtacgatcttggtagccacctctggagatactggt
ggtgcagtggctgcagctttttcaaaggtgaaaaatattgaggttgtgattctctatcct
tcaggaaaggtaagtgaattgcaggaaaggcagctgacaacttttgatgaaaatgtaaag
gcattagaaattgaaggtgatttcgatgattgtcagcaattagtgaaacaagcatttctg
gatgctgatttgagaaaacggctgaatataagctctgccaattcgattaatgttgcccgt
tttttacctcaaatggtctattattttgctccttttattgaatttggcaaagaacctcta
acgatagctgttccaagtggaaattatggcaacctgactgctggattgattgcacaaaaa
atgggcttaccagtagaacaatttattgctggggcaaataggaatgatgtcgttcctaga
tatttgaatagtggcaaatatgaaccacaagaaactattcaaacgatctcaaatgcgatg
gatgtaggtaatccaagcaacttccagcgaatgatggatttgttttcggagaaagaaatc
aaggaaatagtaaaagggtttgccttttcagatgaggatactttagagttgatgaaaaaa
gtatatatagaaagtgactatttattagatcctcatggagcagttggctatttagcctta
gtagaacagatgaaaacttcaaagggtaaaggaattgtacttgagacagctcatccatgt
aaatttatggatgtgatcaagaaagtagcggatgaaaatattttgcccgattcagcccaa
gctctaatgcagaaggaaaagaagagtgtgaagatggaagtggattatgaagtatttaag
gattatttactgcagtaa

DBGET integrated database retrieval system