KEGG   Marivirga tractuosa: Ftrac_2953Help
Entry
Ftrac_2953        CDS       T01365                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
mtt  Marivirga tractuosa
Pathway
mtt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ftrac_2953
DNA repair and recombination proteins [BR:mtt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Ftrac_2953
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ftrac_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR HHH_5 Toprim HHH Cdd1 HHH_8 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ADR22929
JGI: Ftrac_2953
UniProt: E4TSY8
Position
3481267..3481875
Genome map
AA seq 202 aa AA seqDB search
MEFSSKLIESAVNEFSKLPGIGKKTALRLVLHLLKQDENFTTDIAQSLVDMRQNIKYCKK
CHNISDEVVCNICKSHKRDNSIICLVEDTRDVLAIENTSQYNGLYHVLGGIISPIEGIGP
EDLTIDSLMERVSNSDSEVKEIIFGLSPTMEGDTTAFYISKKVKQFGIKTSTIARGIPIG
GELEYADEITLGRSIVSRTAYE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagttttcctctaaattaattgaatctgcagtaaatgaattttcgaagctgcctggc
attggaaaaaagactgcattaagattagtcctacacttattaaaacaagacgaaaatttt
actactgatattgcgcaatctcttgtagatatgcgtcagaatatcaaatactgtaaaaaa
tgccacaatatttctgatgaagtggtttgtaatatctgcaaaagtcataaaagggataat
tctattatctgcttggtggaagatactcgtgatgtactagcaatagaaaatacttctcaa
tacaatggcttgtaccatgttttaggcggaattatttctcctattgaaggaattggacca
gaagacctgactatagatagtttgatggaaagagtttcgaactcagattcagaagtaaaa
gaaatcattttcggactgtctcccactatggaaggcgataccactgctttctatatcagc
aagaaagtaaagcagtttggtattaaaaccagcactattgccagaggaattccaattggt
ggtgagctggaatatgcagatgaaattactttgggtagaagtattgtgagtcgaacggct
tacgaatag

DBGET integrated database retrieval system