KEGG   Marivirga tractuosa: Ftrac_2953Help
Entry
Ftrac_2953        CDS       T01365                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
mtt  Marivirga tractuosa
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ftrac_2953
DNA repair and recombination proteins [BR:mtt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ftrac_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3481267..3481875
Genome map
AA seq 202 aa AA seqDB search
MEFSSKLIESAVNEFSKLPGIGKKTALRLVLHLLKQDENFTTDIAQSLVDMRQNIKYCKK
CHNISDEVVCNICKSHKRDNSIICLVEDTRDVLAIENTSQYNGLYHVLGGIISPIEGIGP
EDLTIDSLMERVSNSDSEVKEIIFGLSPTMEGDTTAFYISKKVKQFGIKTSTIARGIPIG
GELEYADEITLGRSIVSRTAYE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagttttcctctaaattaattgaatctgcagtaaatgaattttcgaagctgcctggc
attggaaaaaagactgcattaagattagtcctacacttattaaaacaagacgaaaatttt
actactgatattgcgcaatctcttgtagatatgcgtcagaatatcaaatactgtaaaaaa
tgccacaatatttctgatgaagtggtttgtaatatctgcaaaagtcataaaagggataat
tctattatctgcttggtggaagatactcgtgatgtactagcaatagaaaatacttctcaa
tacaatggcttgtaccatgttttaggcggaattatttctcctattgaaggaattggacca
gaagacctgactatagatagtttgatggaaagagtttcgaactcagattcagaagtaaaa
gaaatcattttcggactgtctcccactatggaaggcgataccactgctttctatatcagc
aagaaagtaaagcagtttggtattaaaaccagcactattgccagaggaattccaattggt
ggtgagctggaatatgcagatgaaattactttgggtagaagtattgtgagtcgaacggct
tacgaatag

DBGET integrated database retrieval system