KEGG   Marivirga tractuosa: Ftrac_3083Help
Entry
Ftrac_3083        CDS       T01365                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mtt  Marivirga tractuosa
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_3083
   01230 Biosynthesis of amino acids
    Ftrac_3083
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_3083
   00030 Pentose phosphate pathway
    Ftrac_3083
   00051 Fructose and mannose metabolism
    Ftrac_3083
   00052 Galactose metabolism
    Ftrac_3083
  Energy metabolism
   00680 Methane metabolism
    Ftrac_3083
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ftrac_3083
Enzymes [BR:mtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ftrac_3083
Protein phosphatases and associated proteins [BR:mtt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ftrac_3083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3630090..3631070
Genome map
AA seq 326 aa AA seqDB search
MNKINRIGVFTSGGDAPGMNAAIRAVVRAGIYYNKEIVGIYRGYEGMIEGDFEEMDVRSV
ANILQRGGTMLKSARSKEFRTPEGRKKAFEQLKKSNIDALIGIGGDGSFTGMHHLYLEHG
MPYICIPGTIDNDIPGTDYTIGYDTATNTAVEAIDKIRDTALSHNRLFFIEVMGRDSGYI
AISSGIAGGAVSIIIPEEETSIDELVEKLNKGGKKNKTSSLVIVAEGGKSGSAMEIAEKV
KEKSSYFDTKVTILGHLQRGGTPTYFDRLLASKMGVAAIEGLDQGKTDAMVGIRHHDIIF
NKFDDIMNQPKDIHKDDLRIAKILSI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaataagataaatcgaataggtgtttttacctctgggggtgatgctccaggaatgaat
gctgccatacgtgctgtagtaagagcaggtatttattataataaagaaatagtagggata
tatcgcggatatgaagggatgatagaaggtgattttgaagaaatggatgttcgctctgtg
gcaaatattttgcaaagagggggtactatgctgaaatcagcacgatcaaaagaattcaga
acaccagagggtaggaaaaaggccttcgagcaattgaaaaaaagtaatattgatgcctta
attggaattggtggcgatggttcttttacaggaatgcatcatttgtatttggaacatggt
atgccatatatttgtattccgggcaccattgataatgatattcccggaaccgattatacc
attggttatgatacagctaccaatactgcagtggaggcaatagataaaatccgagatact
gccttgtcgcacaaccgtttgttttttattgaagtgatgggtcgtgattctggttatatt
gccattagtagtggaattgcaggaggtgcggtttccattattattcccgaagaggaaaca
tccattgacgaactagtggagaaattaaataagggtggtaaaaagaacaaaacttctagt
ctggtaattgtggcagaaggcggtaagtcaggttcagccatggaaattgccgaaaaagtc
aaagaaaaatcttcttattttgacacaaaagtgactatattaggtcatcttcaaagagga
ggcacacctacctattttgacaggttgttggcaagtaaaatgggcgttgctgcaattgaa
ggtttagatcaaggaaaaacagatgccatggttggcattcgacatcatgatataatattt
aataaatttgatgacattatgaatcagcctaaagatatccataaggacgatttacgaatt
gctaaaatcttatcaatataa

DBGET integrated database retrieval system