KEGG   Marivirga tractuosa: Ftrac_3268Help
Entry
Ftrac_3268        CDS       T01365                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00010  Glycolysis / Gluconeogenesis
mtt00520  Amino sugar and nucleotide sugar metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
mtt01120  Microbial metabolism in diverse environments
mtt01130  Biosynthesis of antibiotics
mtt01200  Carbon metabolism
Module
mtt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ftrac_3268
   00520 Amino sugar and nucleotide sugar metabolism
    Ftrac_3268
Enzymes [BR:mtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Ftrac_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DUF4445
Motif
Other DBs
NCBI-ProteinID: ADR23242
JGI: Ftrac_3268
UniProt: E4TW24
Position
complement(3840649..3841377)
Genome map
AA seq 242 aa AA seqDB search
MEVLGIDIGGSGMKAAIVDLKTGEFIGKRKRFKTPQPATPEAMMKTVVKLQKHFDWSGSI
GCGFPAAIIDGTVKTASNIDKSWIEKPLANMIRKATGCATRVMNDVDVAGLAEMRFGAGK
DHGGTVLILALGTGIGSALFHNQQLMPNTELGHIQFKGDIAEAYAANSIRENEDLSWEVW
GKRLNQYLVEVHKLFWPDLIILGGGVSKKFKKYEKYIDSRLNVIPAELKNHAGIVGAACQ
FL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
ttggaagtattaggcattgacattggaggttctggcatgaaagctgccatagtagattta
aaaaccggggaattcattggtaaacgaaaacgatttaaaacgccacaacccgcaacacca
gaagctatgatgaagactgtagtcaaactacaaaaacacttcgattggtctgggtcaata
ggttgtggttttccagcagccataattgatggaacggtaaaaactgcttcaaatattgat
aaaagctggatagaaaaacctcttgccaatatgattagaaaggccacgggttgtgccact
cgggtcatgaatgatgtagatgttgccggcttagctgagatgcgctttggagcaggtaaa
gatcatggtggaactgttttaatattggcgttaggcactggaattggttcggctttattt
cacaatcagcagctgatgcctaacaccgaactcggacacatacaattcaaaggagatata
gcagaggcttatgccgcaaattctattcgggaaaatgaagaccttagctgggaggtttgg
ggaaagcgtttgaatcaatatttagtagaagtgcataaactattctggcctgatctgatt
attttaggtggtggcgtaagcaaaaagtttaaaaaatatgaaaaatacattgacagcagg
ctgaatgtcatccctgctgaattaaaaaatcatgctgggattgtaggggctgcttgtcag
tttttgtag

DBGET integrated database retrieval system