KEGG   Marivirga tractuosa: Ftrac_3289Help
Entry
Ftrac_3289        CDS       T01365                                 

Definition
UDP-N-acetylmuramoylalanyl-d-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mtt  Marivirga tractuosa
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ftrac_3289
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ftrac_3289
Enzymes [BR:mtt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ftrac_3289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3867005..3868471
Genome map
AA seq 488 aa AA seqDB search
MANLKDILYKVKLISVSGATDIAIDAIQFDSRIVGAGDVFVAIKGTQVDGHEYISKAIEQ
GAVAIVCEDIPSDIHPQVTYVQTDNSAKALGVMAANYFGHPSEKLKLIAVTGTNGKTTTV
SLLHQLFMNLGYHTGMISTVQNQINNAVIPATHTTPDALQLNSLLKKMVDSGCNIVFMEA
SSHAIEQERMAGLKLAGAVFTNISHEHLDYHKTFDNYIKAKKKLFDDLPSDAFALVNVDD
KRGMVMLQNCKASKYTYSLKMMAIYKAKVLSNSIQGLELNIDQKDVWFRQIGYFNAYNLL
AAYATAHLLEEESEEVLMNLSQIELKNGRFEQVPNNAGITAVVDYAHTPDALENVLQTID
NFRTGNEQVLTVVGCGGNRDTTKRPLMAEIACRFSDRVILTSDNPRFEEPEAIIADMQKG
VPVSQVRKVTNLPDRKEAIKLACSFAQKGDIILVAGKGHETYQEIKGERSHFDDKEVVRE
MLSLIHNK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaatttaaaagacatattatataaggtaaaattaatcagcgtttctggagctact
gatattgctattgatgctattcagtttgattctaggattgtgggtgccggagatgtattt
gttgcaataaaaggaacacaggttgatggtcatgaatatatttctaaagccattgaacag
ggagctgtagcgatagtttgtgaagacataccttcggatatccaccctcaggtgacttat
gtgcaaactgacaattcagctaaagcgcttggggttatggcggccaactatttcgggcat
ccatcagagaaattaaaattaattgcggtaacgggtaccaatggaaaaaccacaaccgtg
agtttgttacatcagttgttcatgaatttgggctatcatactggtatgatttctacagtc
caaaatcagattaataatgcggttattcctgcaacacatacgactcctgatgcacttcag
ctgaattccctacttaaaaaaatggtggattctggctgtaatattgttttcatggaagcc
agcagccatgctatcgaacaagaaaggatggcgggtttaaaattagctggagctgttttc
accaatatttcccatgagcatttagattatcataaaacatttgataattacataaaagcc
aaaaagaaactatttgatgatttgccttccgatgcttttgctttggtaaatgtggatgat
aaaagaggtatggtgatgttgcaaaattgtaaagcctcaaagtatacttattcattaaaa
atgatggcgatttataaagccaaagttttaagtaattcaatacaagggttggagcttaat
attgaccaaaaagatgtttggtttagacaaattggctatttcaatgcttataatttgtta
gcagcttatgccactgcacatttattggaagaagaaagtgaagaggtattaatgaatcta
tcccaaatcgaattaaagaatgggcgatttgagcaagtacctaataatgcaggaattacg
gcagtagtagattatgcacatactccggacgcattggagaatgtgttgcaaaccattgat
aattttaggactggcaatgagcaagttttaactgtcgtaggctgtgggggaaatagagat
acaaccaaaagacctttaatggctgaaatagcttgcagatttagtgatagagtgattcta
acatcggataatccaaggtttgaagaaccagaagctatcattgctgatatgcaaaaaggt
gttccagtttctcaggtgagaaaagtaacgaatcttccagaccgaaaagaagccataaaa
ttggcttgcagtttcgctcaaaagggagatatcatattagtggcaggaaaaggtcatgag
acttatcaggaaataaaaggcgagagaagtcatttcgatgataaggaagtagtacgtgaa
atgttgagtttaatacataataaataa

DBGET integrated database retrieval system