KEGG   Marivirga tractuosa: Ftrac_3306Help
Entry
Ftrac_3306        CDS       T01365                                 

Definition
(GenBank) Mg-chelatase subunit ChlI-like protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00860  Porphyrin and chlorophyll metabolism
mtt01100  Metabolic pathways
mtt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ftrac_3306
Enzymes [BR:mtt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ftrac_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_3
Motif
Other DBs
NCBI-ProteinID: ADR23280
JGI: Ftrac_3306
UniProt: E4TL03
Position
complement(3895191..3896714)
Genome map
AA seq 507 aa AA seqDB search
MSYEKLTTQDKLKITTLKDLMKSGYQPKPVKEELRQNLIKKMKAGENVFEGIWGYEDTVI
PDIQRAILSRHNINLLGLRGQAKTRIARMMTLLLDEYVPVLKGTELNDDPMQPLSRQAQD
ILEEQGNDAPVAWMHRDERYTEKLATPDVSVADLIGDVDPIKAATLKLPYSDERVIHYGL
IPRSHRGIFVINELPDLQARIQVALFNILQEGDIQIRGFKLRLPLDLQFVFTANPEDYTN
RGSIITPLKDRIDAQIITHYPESIEIGRKITKQEAAIKDEQNEVVELNELSKDLIEQIAI
EARNSEYIDEKSGVSARLTISAYESLVSAAERRCLINKEQKVYVRMSDFSGVVPAITGKV
ELVYEGEQEGPGIVAQTLVGKAIRSQFDHYFPNPEQLRKDREKKNPYRPISKWFNDGKKI
DLFHDDNESDYKKKLDSIPGLRDLVKTQHKKLSEKETYFMMEFALHGMAEYSLLSKHALA
KGHSFKDLLSSMLNFEDSSDQDDDFNI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgagaaactcactacgcaagataaattaaaaattaccacccttaaagattta
atgaaaagcggttatcagcccaaacccgtcaaggaagaactccgacagaacctcatcaaa
aaaatgaaggctggagaaaatgtttttgaaggcatttggggttatgaagatacggttatt
cctgatatacaaagagcaattctgtcgcgtcataatattaatttattaggcttaagaggt
caggcaaaaaccagaattgctcggatgatgactttattgctggatgaatatgttccagtt
ttaaagggtacagaactcaatgatgaccctatgcaaccactgtcgcgacaagcacaggat
atcttggaagaacaagggaatgatgccccagtggcatggatgcatagagatgagcgctat
actgaaaaattagctactcccgatgtttcagttgctgacctgattggagatgttgaccca
atcaaagcagctacattaaaacttccttattctgatgagcgcgtgatacactacgggtta
attcctcgttcacacagagggatatttgtgatcaatgaattacctgatttacaagctaga
atacaggtagccttatttaatattttacaagaaggagatattcaaatcagaggttttaaa
ttaaggcttcctttagatttacagtttgtctttactgccaatcctgaagattacacaaac
aggggcagtatcatcacaccattgaaagatagaatagatgcgcaaattatcactcattac
cctgaaagcattgaaataggacgaaaaatcacaaaacaagaagctgctataaaagatgag
caaaatgaggtggtggaattaaatgagctatccaaagacttaattgaacaaattgctata
gaagcacgaaatagtgagtatatagatgaaaaaagtggagtttctgccaggctgaccatt
tcagcttacgaaagtttggtcagcgcagcagaacgaagatgtttaatcaacaaagagcaa
aaggtctatgtaagaatgtctgatttttcaggtgttgtgcccgctatcacaggaaaggta
gaattagtttatgagggagagcaagaaggaccaggcattgttgctcaaactttagttggc
aaagccatccgatcgcaatttgatcactatttcccaaatccggagcaattaagaaaagat
agggaaaagaaaaatccttaccgaccaatcagcaaatggtttaatgatggtaaaaaaatt
gacctcttccacgatgacaatgaaagcgattacaagaaaaaattagatagtattccaggt
ttaagggatttggtcaaaacacagcataaaaagctaagcgaaaaggagacctacttcatg
atggaatttgcacttcatggcatggctgaatatagcttattgagtaaacatgcattagcg
aagggacatagctttaaagacctattaagcagtatgttaaattttgaagattcgtccgat
caggatgatgattttaatatttaa

DBGET integrated database retrieval system