KEGG   Marivirga tractuosa: Ftrac_3336Help
Entry
Ftrac_3336        CDS       T01365                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mtt  Marivirga tractuosa
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ftrac_3336
Enzymes [BR:mtt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Ftrac_3336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3931910..3932503
Genome map
AA seq 197 aa AA seqDB search
MISYLKGSIIELEPTHLIIEVGGVGYHVIIPMSTYDAFKSQKEVKVLTHFHVKEDSQTLY
GFYLPEERTVFLDLIGISGIGPSTAIGMLSAMNPNEIKSSIVAENVKQIQSIKGIGGKTA
QRVILELKDRYKKEGLITESTQSSGVSNNSLRNEALSALINLGFAKNSAEKVIDKILQAN
KENITLEQLIKQALKSA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatatttaaaaggaagtattatagaattagaacctactcacctaattattgag
gttgggggagtaggttaccatgttatcataccaatgtctacttatgatgccttcaagagc
cagaaggaggtaaaagtgttgactcattttcatgttaaagaagattcccaaactttatat
ggtttctacctccctgaagaaagaaccgtatttttggatttgataggcatttcaggtata
ggcccctcaacagcaattggaatgctttctgccatgaatcctaatgaaattaaatcttca
atcgttgcggagaatgttaaacaaatccaatctattaaaggaataggagggaaaacggct
caaagagttattttggaattgaaagatcgttataaaaaagaaggtttaattacagaatct
acccaatcttctggagtttcaaacaatagcttgagaaacgaagcgttatctgctttaata
aatttagggtttgccaaaaattctgctgaaaaggttattgataagatattgcaagctaac
aaggaaaatattactttagagcaattaatcaagcaagccttaaaatcagcctaa

DBGET integrated database retrieval system