KEGG   Marivirga tractuosa: Ftrac_3407Help
Entry
Ftrac_3407        CDS       T01365                                 

Definition
glycoside hydrolase family protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mtt  Marivirga tractuosa
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ftrac_3407
Enzymes [BR:mtt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ftrac_3407
Exosome [BR:mtt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ftrac_3407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4008791..4010782
Genome map
AA seq 663 aa AA seqDB search
MLQIIKDDPWLAPYEPDIQTRVDYFKSELDRIQSDYGSLLKYSNRHQELGFQKNKTGFTY
KEWAPEAQALSLVGDFNNWDESAHPMQKDEKGIWEVEVKNEDGLEHLSAVKVRVTAANGK
HDRIPAYVKYAVQNIDNHDFTGRLWVPGKSFQWTDDQFKLSDIKNPVIYECHPGMAQEKE
GVGTFKEFEENILPRIQSLGYNCIQLMAVAEHPYYGSFGYHVANFYAPSSRFGTPEDLKS
LVNAAHKMGIAVIMDVVHSHAVKNFSEGLNDFDGSGNQYFHHGGRGYHTGWDSKLFNYGK
EEVSRFLLSNLKYWLEEFHFDGFRFDGVTSMLYHHHGEGVSFDHYDKYFKEGVDWDAVRY
LQLANTLIHEIKPDAITIAEDMSGMPGTCQSIDEGGLGFDYRLGMGIPDNWIKWLKHKQD
EEWSMQEIWNVLSNRRYGEKTVAYAESHDQAMVGDKTLAFWLMDKEMYWHMKKGDDNLII
DRGIALHKMIRLVTASAGGEAYLNFIGNEFGHPEWMDFPREGNNWSYKYARRQWSLVDNN
ELKYHHLNDFEEAMLELLKSENVLRAAPANLLNVDETNKVLIFERANLIFVFNFHPSNSV
PDYEFWVPKGGKFNYLLNSDDTKFGGHERIDQSTIHESFKKEGGDFIKIYCVNRTALVLK
RNL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaattattaaagacgatccttggttagccccttacgaacctgatatccaaact
cgtgttgattattttaaatcagaattggatagaattcaatctgattatggtagtttatta
aaatattcaaatcgacatcaggagctcggatttcaaaaaaataaaacgggctttacttat
aaagaatgggctccggaagcacaagccttatcattagttggtgattttaataattgggat
gaaagtgctcatcccatgcagaaagatgaaaaagggatctgggaagttgaagtaaagaat
gaggatggattagaacatctatctgctgttaaagtaagagtgactgctgctaatggaaaa
catgacagaattcctgcttatgtaaaatatgcagtgcaaaatattgataaccatgatttt
acagggaggctctgggtaccgggaaaatcatttcaatggacagatgatcaattcaaatta
agtgacattaaaaaccctgtgatttatgaatgtcatcctggaatggctcaggaaaaagaa
ggggttggcacctttaaggaatttgaagagaatattttacccagaatacagtcattaggc
tataattgtattcagttaatggcagtagccgaacatccttattatggttcttttggttat
catgtagccaatttttatgcaccctcttctcgttttggaacgccagaagatttaaaatcc
ttagttaatgctgcccataaaatgggaattgcagtaattatggatgtagtgcattctcat
gcagtcaagaatttttcagaaggcctaaatgattttgatggcagcggaaatcagtatttc
catcatggtggtcgaggatatcacactggctgggattcaaagttatttaattacggaaaa
gaagaagtttctcgtttcttgctatcaaatttaaaatattggttggaagaattccacttt
gatggtttccgttttgatggggtaacttctatgctttaccatcatcatggcgaaggagtc
agttttgatcattatgataaatatttcaaagaaggagttgattgggatgccgttcgttac
ttgcaattagccaataccttaattcatgaaattaagcccgatgctatcaccatagctgaa
gacatgagtggaatgccaggcacttgccagtccattgatgaaggcggtttgggctttgat
tatcgcttgggaatgggaatccccgataattggataaaatggctgaagcataagcaagat
gaagaatggagcatgcaagaaatctggaatgtgctaagcaacaggagatatggagaaaaa
acagtagcctatgccgaatctcacgatcaggcaatggtaggggataaaaccttggctttc
tggctgatggataaagaaatgtattggcacatgaaaaaaggtgatgataatttgataatc
gatcgaggtattgccttacataaaatgattcgcctggttacagcctcagctggtggtgaa
gcttatttgaattttattggtaatgaattcggtcatcccgagtggatggatttccctcga
gaagggaacaattggagttataaatatgccagaagacaatggtcattggtggataataat
gaattgaaataccatcacctcaatgattttgaggaggcaatgcttgagctgttaaaatca
gaaaatgtattgcgagctgctccagctaacctgctcaatgttgatgaaactaataaggtg
ctgatttttgaaagagccaatttgatctttgtattcaattttcatcctagcaattctgtt
cctgattacgaattttgggttcctaaaggaggaaagttcaattatcttttaaatagtgat
gatacaaaatttggaggtcatgaaaggatagatcaatcaacaattcatgaaagctttaaa
aaggagggaggagattttattaagatttattgtgttaatcgaacagctttggttttgaaa
agaaacttgtga

DBGET integrated database retrieval system