KEGG   Marivirga tractuosa: Ftrac_3542Help
Entry
Ftrac_3542        CDS       T01365                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00330  Arginine and proline metabolism
mtt00332  Carbapenem biosynthesis
mtt01100  Metabolic pathways
mtt01130  Biosynthesis of antibiotics
mtt01230  Biosynthesis of amino acids
Module
mtt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ftrac_3542
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Ftrac_3542
Enzymes [BR:mtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Ftrac_3542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DUF1205
Motif
Other DBs
NCBI-ProteinID: ADR23512
JGI: Ftrac_3542
UniProt: E4TNC4
Position
4183040..4183834
Genome map
AA seq 264 aa AA seqDB search
MKTHSKRIVVKIGTNVMTNKDNRIVVPILKRIVDQVARLYEEDVMTVLISSGSVIAGKEV
LDDNEIDTIDNAAQRRQVYSAVGQPRMMRHYYSIFHDYGMRCAQVLATKRDFDFGRHRDN
MINCYEGLLGQGIIPIANEDDAVSLSMSMFSDNDELASLVAELVDADALILLTDTDGIFD
GHPDHDDSNVIKSVSTDQEVEQFIQESDKKEGEGRGGMESKINVAKGAASKDIVTYIANG
KREDVIIDIVHGKDVGTRIYKEDE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacacatagtaaaagaattgtagttaaaatcggtaccaatgtgatgaccaataag
gataatcgcattgtggtacctattttgaaaagaatagtagatcaagtagcacgcctatat
gaagaagatgttatgacagtattgatttcttctggttctgttatagcaggaaaggaagtg
ctagatgataatgaaattgatacaattgataatgctgcccaaagaaggcaggtatactct
gcagttgggcaaccaaggatgatgcgtcattattacagtattttccatgattatggaatg
cgatgtgctcaggttttggcaactaaaagggattttgattttggtaggcatagagataat
atgatcaattgctatgaaggcctgctagggcaaggaataattccaattgcgaatgaagat
gatgccgtttcattatcaatgtccatgttttctgataatgatgaattggcaagtttggta
gctgaacttgtggatgcagatgcactaattttactgacagatactgatggaatatttgat
ggtcaccctgatcatgacgattctaatgtgatcaaaagtgtcagtactgatcaggaagtg
gaacaatttatccaagaatccgataaaaaagaaggggaaggtcgaggaggaatggaatcc
aagatcaatgtagctaaaggtgctgcgtcaaaggatattgttacctacatcgcaaatggt
aaacgtgaagatgttatcatcgacatagtgcatggtaaagatgtaggaaccaggatttat
aaagaggatgaatag

DBGET integrated database retrieval system