KEGG   Marivirga tractuosa: Ftrac_3549Help
Entry
Ftrac_3549        CDS       T01365                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mtt  Marivirga tractuosa
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ftrac_3549
Enzymes [BR:mtt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ftrac_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4196155..4197228)
Genome map
AA seq 357 aa AA seqDB search
MTKKQEIINAFDPNGIGNVDNIFALPFDEKTADLILIPVPWEVTVSYEAGTAQGPQHILE
ASTQVDLYQKDIIDAWKMGIQMLPINQDLLTKSNKHRIMAEEYIGLLESGEENSDKGKNL
LKEVNSVCSEMVEWVKTESLKQLDKHKLLGLVGGDHSTPLGAVQALATNHETFGVLQIDA
HMDFRKAYENFQYSHASISYNMLQTVPQIEKMVQVGIRDFCEEEIKFAEKQGERVSVFYD
DDIKVGMFEGESWTIICDRIIKELPNEVYITFDIDGLRPELCPNTGTPVPGGISYSEIIY
LLTRLVKNGKKIIGFDLNEVAPGENTDWNGNVGARILYRLCNLMGVSQGKLEWDESF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaaacaggaaataatcaatgcctttgaccccaacggaatcggcaatgtagat
aatatttttgctttaccttttgatgaaaaaactgcagatttaattttaattcccgttcca
tgggaagtgactgtatcttatgaagcgggtacagcacaagggccacaacatattctggaa
gcctccacacaagtcgatttatatcagaaagatattattgatgcctggaaaatgggaatt
caaatgctcccaatcaatcaggatttattgaccaaaagcaataagcatcgcataatggcg
gaggaatatattggcttattggaatcaggagaagaaaatagcgataaaggaaaaaaccta
ttaaaggaagtcaactcggtttgttctgaaatggtagaatgggtaaaaaccgagtcttta
aagcaattggataagcataaactcttaggactagtaggcggtgaccacagtacgccttta
ggcgcagttcaagctttagcaaccaatcatgaaacttttggcgtacttcaaattgatgcc
catatggatttcaggaaagcttatgagaattttcaatattctcatgcctccatctcttat
aatatgttgcaaacagttccgcaaatcgaaaaaatggttcaggtagggattcgggatttt
tgcgaagaagaaatcaaatttgctgaaaagcaaggggaaagagtgagtgttttctatgat
gatgatataaaagtgggcatgtttgaaggggaatcttggactatcatctgcgatagaatc
ataaaagaattaccaaatgaagtttatatcacattcgatattgatggtttaagacctgaa
ttatgtcccaataccggtacgccagtgccaggaggcattagctattccgaaatcatttat
ttattgactaggttggttaaaaacggcaagaaaatcattggctttgatttgaatgaagtc
gctccaggagaaaacacggattggaatggcaatgtaggcgctaggattttataccgctta
tgcaatttaatgggtgtctctcaaggaaagctggaatgggatgaaagtttttaa

DBGET integrated database retrieval system