KEGG   Marivirga tractuosa: Ftrac_3651Help
Entry
Ftrac_3651        CDS       T01365                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mtt  Marivirga tractuosa
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ftrac_3651
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ftrac_3651
Enzymes [BR:mtt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ftrac_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4333916..4335190)
Genome map
AA seq 424 aa AA seqDB search
MNKQEKINQLISDWDTNPRWKDVERTYTAEEVVKLAGTVKIDHSLARLGAERLWDLLKTE
EFVSGLGALTGNQAIQEVQAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPNVVKR
INNALLRADQIQSVSGEGDIHWMAPIVADAEAGFGGNLNAFELMKGMIEAGAAGVHFEDQ
LSSAKKCGHLGGKVLVPTQEAINKLISARLATDVMGVPTIIIARTDADAANLLTSDVDER
DHQFLTGERSDEGFFGVKNGLEQAINRGLAYAPYADLVWCETSHPDLGEAREFAQAIKEK
YPHKMLAYNCSPSFNWAAKLTESEMLEYREKLAEMGYKFQFITLAGFHALNTAMFELATA
YKNKGMAGYSELQQREFALQEQGFKAVKHQAFVGTGYFDAVQNAVTQGKSSTTALKGSTE
EAQF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcaagaaaaaatcaatcaattaatatcagattgggacactaacccaagatgg
aaagacgtagaacgaacttatactgctgaagaagtagttaaattagcaggaaccgtaaaa
attgaccacagcttagcccgattaggcgctgaaagattatgggatttgctaaaaacagaa
gaattcgtatctggcttaggagccttgactggaaaccaagccatacaagaagttcaggcc
ggattaaaagccatttacttaagcggatggcaagttgcagcagatgctaaccttgcagga
caaatgtatcctgaccagagtttgtatcctgcagatagtgttcctaatgtagtgaaacga
attaacaacgcacttttgagagctgatcaaattcagtcggttagcggagaaggtgatatt
cattggatggcacctatagtggcagatgctgaagctggatttggtggtaatttgaatgct
tttgaattaatgaaaggcatgatagaagctggagcagctggagtacattttgaagaccaa
ttatcatctgctaagaaatgtggacacttgggaggcaaggtgttagttccaactcaagaa
gccatcaataaattgatttcggcaagattggcaactgatgttatgggagttccaactatt
attattgcaagaacggatgcagatgctgctaatctattaacctcagatgttgatgaaaga
gatcatcaatttctaacaggtgagagatcagacgaaggattctttggcgttaaaaacgga
ttggaacaagccattaatagaggacttgcctatgcgccatatgctgatttggtatggtgt
gaaacttcgcatcctgatttgggagaagcaagggaatttgcacaagccatcaaggaaaaa
tatccacataaaatgttggcttataattgctcgccttcattcaattgggcagcaaaactt
actgaaagtgaaatgttagagtaccgagaaaaattagctgaaatgggctacaaattccag
ttcatcacattagctggattccatgccttaaatacagctatgttcgaattggctactgct
tataaaaataaggggatggccgggtattctgaattacagcaaagagaatttgctttacaa
gagcaaggctttaaagcagttaaacatcaagcttttgtggggactggctattttgatgct
gttcagaatgctgtcactcaaggcaaatcttccactactgcattgaaaggttcaacagaa
gaggcacagttttag

DBGET integrated database retrieval system