KEGG   Marivirga tractuosa: Ftrac_3719Help
Entry
Ftrac_3719        CDS       T01365                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mtt  Marivirga tractuosa
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ftrac_3719
Enzymes [BR:mtt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ftrac_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4410268..4411125
Genome map
AA seq 285 aa AA seqDB search
MEAKDKAFSYKKTLLTKGNLIDLSRPKVMGIINATPDSFYDGGQNIDIDKAVLKVEEMLK
DGADIIDIGGYSTKPNASEVSINEEERRVIPLIETIIEKFPSTVISIDTFRSEVAEKAVA
AGASIINDVSGGNLDGEMFNTVAKLKVPYILMHMRGTPASMQKLTDYEHLVKDIVLELSE
KLEILRSLQVNDIIIDPGFGFAKTLAQNYEILNNLSYFKQLECPILVGVSRKSMIYKLLG
VDAVNALNGTTALNMAALLNGGAILRVHDVKEAVETVKIFNQLTT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttggaagcgaaagataaagcattttcttataaaaaaacactccttaccaaggggaactta
atcgatttgtcccgcccgaaggttatgggcattataaatgctactccagattcattttac
gatgggggtcaaaatattgacatagataaagctgtgttgaaagtagaagagatgttgaag
gatggtgcagatattatagatataggggggtactctactaaaccaaatgctagcgaagtt
tctattaatgaagaggagaggagggtaattccattaattgaaaccataatcgagaagttt
ccaagtaccgtaatttcaattgatacattccgttcagaagtggcagaaaaggctgtggca
gcgggagcctcaattataaatgatgtttctggaggaaatttggatggagagatgtttaat
acagtagctaaattaaaagtgccttatattttaatgcatatgcgaggaactccagctagt
atgcaaaaattgacagattatgagcatctagtaaaagatatcgtattagaattaagtgaa
aaactggaaattcttcgttctttgcaagtgaatgatatcattattgatcctggcttcgga
tttgcaaaaaccttggctcagaattatgaaatcctcaataatttgtcctattttaaacaa
ttagaatgccctattttagtgggtgtatctcgtaaatcgatgatatacaaacttttgggt
gttgatgctgttaatgcattaaacgggacaaccgccttaaatatggctgctttgctaaat
ggaggtgctattttaagagttcatgatgtgaaagaagcagtggaaacagtgaaaattttt
aaccaattaacaacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system