KEGG   Marivirga tractuosa: Ftrac_3734Help
Entry
Ftrac_3734        CDS       T01365                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mtt  Marivirga tractuosa
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ftrac_3734
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Ftrac_3734
Enzymes [BR:mtt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ftrac_3734
Two-component system [BR:mtt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Ftrac_3734
Bacterial motility proteins [BR:mtt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ftrac_3734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4426316..4426909
Genome map
AA seq 197 aa AA seqDB search
MARFNLDNKYKAIVIGGSAGSFQGITQILSSIPADFSLPIILCLHRLKHVRNGFVEALSI
KSIKPVVEPYDKENIKRGKVYLAPANYHLSIELGNSIALSTEEMFNNSRPSIDITLETAA
YNYRDKLIGILLSGANKDGALGMKRIKDRKGLTIIQDPEECMIDTMPTAAKNITEIDYTL
KVQEIIQFLKELDKLYK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatttaatcttgataataaatataaagcgatagtaatcggaggatctgcaggt
agttttcagggtataacccaaattctttcttctattcctgctgatttcagcttgcctatt
atcctatgtttacatagattaaagcacgtgcgcaatggttttgtggaagcattgtctata
aaaagcattaagcccgtagtggagccttatgataaggaaaatattaaaagagggaaggtt
tatttagccccagcaaactatcatctttccattgagctaggtaattcaattgctttgtct
acagaagagatgttcaataattccaggccttctatcgatatcactttagaaactgcggcc
tataattacagagataaattgattggtattttattgtccggagcaaacaaagatggagcc
ttggggatgaagagaattaaagatagaaaagggcttactatcatccaagatccagaagaa
tgcatgatagataccatgccaactgcggcaaaaaatataaccgaaattgattacacttta
aaagttcaagagattatccaattcttaaaggaattggataaattgtataaatga

DBGET integrated database retrieval system