KEGG   Marivirga tractuosa: Ftrac_3763Help
Entry
Ftrac_3763        CDS       T01365                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtt  Marivirga tractuosa
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ftrac_3763
Enzymes [BR:mtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ftrac_3763
Exosome [BR:mtt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ftrac_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4459442..4460941
Genome map
AA seq 499 aa AA seqDB search
MEKSQYILSLDQGTTSSRAILFNEKAEIVAVAQKEFEQFFPQSGWVEHDANEIWTSQASV
ATEAITKANITPTQIAGIGITNQRETTIVWDRNTGKPIHKAIVWQDRRTANYCNELKKKG
LSEKINDKTGLIIDAYFSATKIKWILDNVEGARAKAENGDLCFGTVDSWLVYKLTSGKHH
FTDITNASRTMIFNIHEKKWDKELLDLFEIPESMLPEVKSSSEVYCTTAGDLFSHKIPIA
GIAGDQQAALFGQLCSEKGMAKTTYGTGCFLVMNTGDEPVKSKNKLLTTVAWQIGDKVQY
ALEGSVFIGGAAIQWLRDGLELFRKASESETLATSLKDNEGVYFVPALTGLGAPYWNQDA
RGTFFGITRGTTKAHMARAALEAIAYQVNDVLAAMEKDAGHKTQEMRVDGGASENNFLMQ
FQSDLVDCTITRPKITETTAVGAAFLAGLAVGYWKDMNALQSLWEAEQSYNPEMDKEEVK
KLLHFWHKAVDRSQDWLES
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatctcaatatattttatccctcgatcagggaaccacaagctcaagagctatt
ttattcaatgaaaaagccgagatagtagcggttgctcaaaaggaatttgaacagtttttc
ccgcaatcgggctgggtggaacatgatgccaacgaaatctggacttcccaagcttcagtt
gctactgaagccatcacaaaggcaaatattacgcccactcaaattgcaggaatcgggata
accaatcaaagagaaaccactatagtttgggatagaaacactggaaaacccatccataaa
gcaattgtttggcaagacaggagaacggcaaattattgcaatgaattaaaaaagaaaggc
ttatctgaaaagatcaatgataaaacagggttaattatagacgcctatttttcagccact
aaaattaaatggattttagataatgtagaaggagctagggctaaagccgaaaatggagat
ttatgttttggtacggtggatagctggctggtttataaattgacttctggcaaacatcat
tttaccgatatcaccaatgccagtcgaaccatgattttcaatatccatgagaaaaagtgg
gataaggaattgctggatttatttgagatccctgaatctatgttgcctgaagtaaagtca
agcagcgaagtttattgcaccacagcaggcgatttgttttctcataaaattccaattgca
ggaatagctggagaccaacaagccgcacttttcggacagctttgctctgaaaagggaatg
gcaaaaacaacttatggaacaggttgctttttggtaatgaatactggagatgaacccgtt
aaatccaagaataaattattgactactgtggcttggcaaataggagataaggttcaatat
gctttagaaggcagtgtttttataggaggggcagccattcaatggctacgagatggattg
gagcttttcagaaaagcaagtgaatcagaaacgctggcgacttccttgaaggataatgaa
ggcgtttattttgtgcctgcattgacgggattaggtgcgccttactggaatcaagatgcg
agaggtacattttttggaattaccagaggaactacaaaagcacatatggctagagcagcc
ttggaagcgattgcctatcaggtaaatgatgttttggcagccatggaaaaagatgctgga
cataaaacccaagaaatgagagtagatggtggagcttctgaaaataatttcctaatgcaa
ttccaatctgatttggtggattgtaccattacacgtccgaaaataaccgagacgactgca
gtgggtgccgcattcttggcaggattagcagtaggttattggaaagatatgaatgccttg
caatccctttgggaagccgaacaatcctataatcctgaaatggataaagaagaagttaaa
aaattattgcatttttggcacaaggctgttgaccgcagtcaagattggttagaatcataa

DBGET integrated database retrieval system