KEGG   Mycobacterium tuberculosis H37Rv: Rv0013Help
Entry
Rv0013            CDS       T00015                                 

Gene name
trpG
Definition
(RefSeq) anthranilate synthase component II
  KO
K01664  
para-aminobenzoate synthetase component II [EC:2.6.1.85]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rv0013 (trpG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     Rv0013 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
14914..15612
Genome map
AA seq 232 aa AA seqDB search
MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPE
RAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQ
GLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTGLPIHGVQFHPESILTEG
GHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcctggtcgttgacaactacgacagcttcgtgttcaacctggtgcagtacctc
ggccagctcggcatcgaggccgaggtgtggcgcaacgacgaccaccggctatccgatgag
gccgccgtcgccggccaattcgacggtgtcctgctcagtcccggtccgggtaccccggag
cgcgcgggcgcgtcggtgagtatcgtgcacgcgtgtgcggcagcacacacccctttgctg
ggggtctgccttgggcaccaagccatcggcgttgcgttcggcgccaccgtggaccgtgcg
cccgagctattgcacggcaagaccagcagcgtattccacaccaatgtcggtgtgctacaa
gggcttccggatcccttcacggccactcgataccattcgttgacaattctgcctaagtcg
ctgccagcggtgctgagggtcacggcccgcactagcagcggtgtgatcatggccgtgcag
cacaccgggctgccgatccacggtgtccagttccatccggagtcgattctcaccgagggc
gggcaccgcatactggccaactggctcacctgctgcggatggacgcaagacgacaccctg
gtacgtcggctggaaaacgaagtgctcaccgccatctcaccgcacttcccaacttcaacc
gctagcgcgggcgaagctactggccgaacctcagcgtga

DBGET integrated database retrieval system