KEGG   Mycobacterium tuberculosis H37Rv: Rv0112Help
Entry
Rv0112            CDS       T00015                                 

Gene name
gca
Definition
(RefSeq) GDP-mannose 4,6-dehydratase
  KO
K15856  
GDP-4-dehydro-6-deoxy-D-mannose reductase [EC:1.1.1.281]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv0112 (gca)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0112 (gca)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.281  GDP-4-dehydro-6-deoxy-D-mannose reductase
     Rv0112 (gca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
136289..137245
Genome map
AA seq 318 aa AA seqDB search
MKVWITGAGGMMGSHLAEMLLAAGHDVYATYCRPTIDPSDLQFNGAEVDITDWCSVYDSI
ATFRPDAVFHLAAQSYPAVSWARPVETLTTNMVGTAIVFEALRRVRPHAKIIVAGSSAEY
GFVDPSEVPINERRELRPLHPYGVSKAATDMLAYQYHKSYGMHTVVARIFNCTGPRKVGD
ALSDFVRRCTWLEHHPEQSAIRVGNLKTKRTIVDVRDLNRALMLMLDKGEAGADYNVGGS
IAYEMGDVLKQVIAACKRDDIVPEVDPALLRPTDEKIIYGDCSKLAAITGWQQEICLTQT
IADMFDYWRSKSESALMV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtggatcactggggctggcggaatgatggggtcacatctcgccgaaatgttg
ctggccgccggacacgatgtgtacgctacctactgcaggccgaccatcgatccgtcggac
ctgcaattcaacggagcagaagtcgatatcaccgactggtgctcggtctacgattcgata
gcgacattccgccccgacgcggtatttcatctcgcggcccaaagctatccggcggtttcg
tgggcccggccggttgagacgctgaccaccaacatggttggcaccgccatcgttttcgaa
gcactacgtcgcgtgcgaccgcacgcaaagattattgttgcgggctcgtcggccgaatat
ggatttgttgacccatccgaggttccgattaatgagcggcgagaacttcgcccgctccat
ccgtatggtgtttctaaggcggccaccgacatgctggcgtatcaatatcacaagtcttac
ggcatgcacaccgtcgtcgctcgtatcttcaattgcaccgggccacgcaaagtcggagat
gcactttccgatttcgtccgccgttgtacatggttggagcaccatccggaacaaagtgcc
atccgggtgggaaatcttaagacgaaacggactatcgtggacgtccgcgatctcaatcgg
gcgttgatgctgatgctggataaaggcgaggccggggctgactacaatgtgggaggttcg
atcgcctacgagatgggcgacgttctcaaacaagtaatcgcggcttgtaaacgtgacgat
atcgtgccggaagtcgaccccgcccttcttcggcccaccgacgaaaagatcatctacgga
gattgcagcaagctggcggccataacaggctggcaacaagaaatctgtttgactcagacg
attgccgacatgttcgattattggcgtagcaaatccgagtccgccctgatggtgtga

DBGET integrated database retrieval system