KEGG   Mycobacterium tuberculosis H37Rv: Rv0112Help
Entry
Rv0112            CDS       T00015                                 

Gene name
gca
Definition
(RefSeq) GDP-mannose 4,6-dehydratase
  KO
K15856  GDP-4-dehydro-6-deoxy-D-mannose reductase [EC:1.1.1.281]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00051  Fructose and mannose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv0112 (gca)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0112 (gca)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.281  GDP-4-dehydro-6-deoxy-D-mannose reductase
     Rv0112 (gca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 B12-binding 3Beta_HSD DapB_N 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 886907
NCBI-ProteinID: NP_214626
TubercuList: Rv0112
UniProt: L0T5J9 O53634
Position
136289..137245
Genome map
AA seq 318 aa AA seqDB search
MKVWITGAGGMMGSHLAEMLLAAGHDVYATYCRPTIDPSDLQFNGAEVDITDWCSVYDSI
ATFRPDAVFHLAAQSYPAVSWARPVETLTTNMVGTAIVFEALRRVRPHAKIIVAGSSAEY
GFVDPSEVPINERRELRPLHPYGVSKAATDMLAYQYHKSYGMHTVVARIFNCTGPRKVGD
ALSDFVRRCTWLEHHPEQSAIRVGNLKTKRTIVDVRDLNRALMLMLDKGEAGADYNVGGS
IAYEMGDVLKQVIAACKRDDIVPEVDPALLRPTDEKIIYGDCSKLAAITGWQQEICLTQT
IADMFDYWRSKSESALMV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtggatcactggggctggcggaatgatggggtcacatctcgccgaaatgttg
ctggccgccggacacgatgtgtacgctacctactgcaggccgaccatcgatccgtcggac
ctgcaattcaacggagcagaagtcgatatcaccgactggtgctcggtctacgattcgata
gcgacattccgccccgacgcggtatttcatctcgcggcccaaagctatccggcggtttcg
tgggcccggccggttgagacgctgaccaccaacatggttggcaccgccatcgttttcgaa
gcactacgtcgcgtgcgaccgcacgcaaagattattgttgcgggctcgtcggccgaatat
ggatttgttgacccatccgaggttccgattaatgagcggcgagaacttcgcccgctccat
ccgtatggtgtttctaaggcggccaccgacatgctggcgtatcaatatcacaagtcttac
ggcatgcacaccgtcgtcgctcgtatcttcaattgcaccgggccacgcaaagtcggagat
gcactttccgatttcgtccgccgttgtacatggttggagcaccatccggaacaaagtgcc
atccgggtgggaaatcttaagacgaaacggactatcgtggacgtccgcgatctcaatcgg
gcgttgatgctgatgctggataaaggcgaggccggggctgactacaatgtgggaggttcg
atcgcctacgagatgggcgacgttctcaaacaagtaatcgcggcttgtaaacgtgacgat
atcgtgccggaagtcgaccccgcccttcttcggcccaccgacgaaaagatcatctacgga
gattgcagcaagctggcggccataacaggctggcaacaagaaatctgtttgactcagacg
attgccgacatgttcgattattggcgtagcaaatccgagtccgccctgatggtgtga

DBGET integrated database retrieval system