KEGG   Mycobacterium tuberculosis H37Rv: Rv0131cHelp
Entry
Rv0131c           CDS       T00015                                 

Gene name
fadE1
Definition
(RefSeq) acyl-CoA dehydrogenase FadE1
  KO
K00249  
acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0131c (fadE1)
   01212 Fatty acid metabolism
    Rv0131c (fadE1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rv0131c (fadE1)
  Lipid metabolism
   00071 Fatty acid degradation
    Rv0131c (fadE1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv0131c (fadE1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rv0131c (fadE1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     Rv0131c (fadE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(158315..159658)
Genome map
AA seq 447 aa AA seqDB search
MPVRRRAGERLPTVWDFETDPQYQSKLDWVEKFMAEELEPLDLVALDPYDKKNADTMAIL
RPLQRQVKDQGLWAAHLRPELGGQGFGQVKLALLNEIIGRSRWAPSAFGCQAPDSGNAEI
LALFGTDEQKARYLRPLLDGEITSCYSMTEPQGGSDPGLFVTAATRDAAGNGDWIINGEK
WFSTNAKHASFFIVMAVTKPEARTYEKMSLFIVPADTPGIEIVRNVGVGAESTRHASHGY
IRYHDVRVPADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIALARRAFDMMCERALSRQTR
HGRLADLQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHDYQKVRRDIAAVKVAMPQVLH
DVVQRAMHLHGALGVSDEMPFVKMMLAAESLGIADGATELHKMTVARRTLREYQPVTTLF
PSQHIPTRRAHAEAWLAQRLEHAIAEF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcgacgccgcgccggggaacggttgccgacggtgtgggacttcgaaaccgac
ccgcaataccagtccaagctggattgggtcgaaaaattcatggccgaggaactcgaaccg
ctcgatctggtcgccctcgatccttacgacaaaaagaacgccgacacgatggcgatcctg
cggccgctgcagcggcaggtgaaagaccaggggttgtgggccgcgcatttgcgtcccgaa
ctcggcggacagggcttcggtcaggtcaagctggcgctgctcaacgagatcatcggccgc
tcccggtgggcgccgtcggcgttcggctgtcaggcgccggactccggcaacgccgagatc
ctggcgctgttcggcaccgacgagcagaaagcccgctatctacgaccgctgctcgacggc
gagatcacctcctgctattcgatgaccgagccgcagggtggttccgatcccgggctgttc
gtgaccgcggcgacccgcgatgccgcgggaaacggggactggatcatcaacggcgagaag
tggttttccaccaacgccaagcatgcgtcgttctttatcgtcatggccgtcaccaagccg
gaagcccgtacgtacgagaagatgtcgctgttcatcgtcccggccgacaccccgggcatc
gagatcgtgcgcaacgtcggtgtgggagccgagtccacccggcacgccagccacggctac
atccgctaccacgacgtccgggtgccggccgatcatgtgctcggcggcgagggccaagcg
ttcatgatcgcgcagacccgattgggcggcggccgaatacatcacgcgatgcggacaatc
gcgctggcgcgcagagcattcgacatgatgtgcgagcgtgccctgtcgcgccagactaga
cacgggcggctcgccgatctgcagatgacccaggagaagatcgccgatagttggatccag
atcgagcagttccggctgctggtactgcgcaccgcgtggcttatcgacaaacaccacgac
tatcaaaaggtgcgccgcgacatcgcggcggtcaaggtggcgatgccccaggtgctgcat
gacgtcgtgcagcgggccatgcacctgcacggcgcgctcggggtctccgacgagatgccg
ttcgtcaagatgatgctggcagccgagtcactgggcatcgccgacggcgccactgagctg
cacaagatgaccgtcgcccgccgtacgctgcgcgaataccagccggtgacaacgcttttc
ccgtcacagcacattccgacccggcgcgcgcacgccgaggcctggctggcccaacgcctc
gagcacgcgatcgccgaattctga

DBGET integrated database retrieval system