KEGG   Mycobacterium tuberculosis H37Rv: Rv0155Help
Entry
Rv0155            CDS       T00015                                 

Gene name
pntAa
Definition
(RefSeq) NAD(P) transhydrogenase subunit alpha PntAa
  KO
K00324  
NAD(P) transhydrogenase subunit alpha [EC:1.6.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv0155 (pntAa)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     Rv0155 (pntAa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
183622..184722
Genome map
AA seq 366 aa AA seqDB search
MTDPQTQSTRVGVVAESGPDERRVALVPKAVASLVNRGVAVVVEAGAGERALLPDELYTA
VGASIGDAWAADVVVKVAPPTAAEVGRLRGGQTLIGFLAPRNADNSIGALTQAGVQAFAL
EAIPRISRAQVMDALSSQANVSGYKAVLLAASESTRFFPMLTTAAGTVKPATVLVLGVGV
AGLQALATAKRLGARTTGYDVRPEVADQVRSVGAQWLDLGISASGEGGYARELTDDERAQ
QQKALEEAISGFDVVITTALVPGRPAPTLVTAAAVEAMKPGSVVVDLAGETGGNCELTEP
GRTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLLIKDGRLAPDFDDEVIAQSCV
TRGKDS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacagatccgcagacgcagagcaccagggtcggggtggttgccgagtcggggcccgac
gaacgacgggtcgcgctggttcccaaggcggtcgcgtcgctggtgaaccgtggtgtggcg
gtcgtggtcgaggccggtgcgggcgagcgcgcgctgcttcccgatgagctctacaccgct
gtcggtgccagcatcggggatgcttgggccgccgacgtcgttgtcaaggtcgcgccgccg
acggcggcggaggtcggccggttgcgcggtgggcagacactgatcggctttctagcgccc
cgtaatgctgacaactcgatcggcgcgctgacccaggccggggtgcaggcgttcgcgctc
gaggccatcccgcgcatctcgcgggcgcaggtgatggacgcgctgtcgtcgcaagccaac
gtgtctgggtataaggctgtgctgctcgcggcctcggaatcgacccggttctttccgatg
ctgacgacggcggccggaacggtgaagccggccacggtgctggtgctcggcgtcggcgtg
gccggcctgcaggcgctggcgacggccaaacggctaggcgcgcgcaccacgggctacgat
gtgcgtcccgaggtggccgaccaggtccgatcggtgggcgctcaatggcttgatttgggc
atctcagcgtccggtgagggcggttacgcccgcgaactgaccgacgacgagcgcgcccag
cagcaaaaggcattggaagaagcgatcagtggcttcgacgtggtgatcaccaccgcgctg
gtgccgggccgcccggcgccaacgttggtgaccgccgctgcagtggaagcgatgaagcct
ggcagcgtggtggtggatctcgccggcgagacgggcggcaactgcgaattgaccgagccc
ggccggacagtcgtcaagcacgacgtcaccattgccgcaccgctgaacctgccggccacg
atgcccgagcacgccagcgagctctacagcaagaacatcaccgcgctactcgacttgttg
atcaaagacggcaggctggccccggacttcgacgacgaggtgattgcccagtcgtgtgtc
acccgcgggaaggactcctag

DBGET integrated database retrieval system