KEGG   Mycobacterium tuberculosis H37Rv: Rv0183Help
Entry
Rv0183            CDS       T00015                                 

Definition
(RefSeq) lysophospholipase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 Abhydrolase_2 DLH Esterase PAF-AH_p_II FSH1
Motif
Other DBs
NCBI-GeneID: 886785
NCBI-ProteinID: NP_214697
TubercuList: Rv0183
UniProt: O07427
Position
214088..214927
Genome map
AA seq 279 aa AA seqDB search
MTTTRTERNFAGIGDVRIVYDVWTPDTAPQAVVVLAHGLGEHARRYDHVAQRLGAAGLVT
YALDHRGHGRSGGKRVLVRDISEYTADFDTLVGIATREYPGCKRIVLGHSMGGGIVFAYG
VERPDNYDLMVLSAPAVAAQDLVSPVVAVAAKLLGVVVPGLPVQELDFTAISRDPEVVQA
YNTDPLVHHGRVPAGIGRALLQVGETMPRRAPALTAPLLVLHGTDDRLIPIEGSRRLVEC
VGSADVQLKEYPGLYHEVFNEPERNQVLDDVVAWLTERL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacccggactgaacggaatttcgcgggcatcggcgatgtgcgcatcgtctac
gacgtctggacgccggacaccgcgccgcaagcggtggtcgtgctggcccatggtctgggc
gagcatgcccgccgctacgaccatgtcgcgcagcggctcggcgcggccggcctggtcacc
tatgcgcttgaccaccgcgggcatggccgctcgggtggcaaacgggtgctagtgagagac
atctccgagtacaccgctgacttcgacaccctcgttgggatcgccacccgggaatatccc
gggtgcaagcgcatcgtgctcgggcacagcatgggcggcggcattgtgttcgcttacggt
gtcgaacgtccagacaactacgacctgatggtgctttcggcgccggcggtggcggcacag
gacctggtgagcccggtagtggcggttgccgccaagcttctgggcgtcgtggtgcccggc
ctgccggtgcaggaactggattttactgccatctctcgcgaccctgaggtggtccaggct
tacaacaccgacccactcgtgcaccacggacgggttccggccgggattggccgcgcgctg
ctgcaggtgggcgagaccatgccgcggcgagcaccggcattgaccgcgccgctgctagtg
ctgcacggcaccgatgaccggctgatccccatcgagggcagccgtcgcctggtcgaatgt
gtgggatcggccgacgtgcagctgaaggagtatcccgggctgtaccacgaggtgttcaac
gagccggagcgcaaccaggtgctcgacgatgtggtcgcctggctcaccgagcggttgtag

DBGET integrated database retrieval system