KEGG   Mycobacterium tuberculosis H37Rv: Rv0186Help
Entry
Rv0186            CDS       T00015                                 

Gene name
bglS
Definition
(RefSeq) beta-glucosidase BglS
  KO
K05349  
beta-glucosidase [EC:3.2.1.21]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rv0186 (bglS)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rv0186 (bglS)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Rv0186 (bglS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
216269..218344
Genome map
AA seq 691 aa AA seqDB search
MTDDERFSLLVGLTGASDLWPVRDERIPQGVPMCAGYVPGIPRLGVPALLMSDAGLGVTN
PGYRPGDTATALPAGLALAASFNPVLARSSGKAIGREARSRGFNVQLAGAINLARDPRNG
RNFEYLSEDPLLSATMAAESIIGIQQQGVIATTKHFSLNCNETNRHWLDAVIDPDAHRES
DLLAFEIVIERSQPGAVMAAYNKVNGDYAAGNDHLLNDVLKGAWGYRGWVMSDWGGTPSW
ECALAGLDQECGAQIDAVLWQSEAFTDRLRAAYADGNLPKGRLSDMVRRILRSMFAVGID
RWKPAPAPDMNAHNEIAAQMARQGIVLLQNRGLLPLAPESAGRIAVIGGYAHLGVPAGYG
SSAVTPPGGYAGVIPIGGSGLAAGLRNLYLLPSSPLSELRKRLPNAQFEFDPGINPAEAV
LAARRADIAIVFAIRAEGEGFDSADLSLPWGQDALIAAVASANANTVVVLETGNPVTMPW
RDSVNAIMQAWYPGQAGGQAVAEIVTGQVNPSGRLPITFPVDLGQTPRSQPPELGAPWGT
STTIHYTEGADVGYRWFASTNQTPMFAFGHGLSYTSFEYRDLVVTGGHTVHASFSVTNTG
DRSGADVPQLYMIAAPGESRLRLLGFERVELEPGQTRRVRIEADPRLLARYDGEARSWRI
EPGGYTVAVGASAVALKLAAKVKLAGRGFGR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgagcgattctcactgttggtcggcctgaccggggccagcgatctgtgg
ccggtgcgcgatgaacgcatcccacagggcgtgccgatgtgtgccgggtatgtgccgggg
attccccggctcggggtcccggccttgttgatgagcgatgccggtctgggcgtcaccaac
cctggctaccgccccggtgacaccgctacggcgctgcccgccggccttgccctagcggcc
agctttaacccggtgctggcccggtcctcgggcaaagcgatcggccgggaggcgcgcagt
cgcgggttcaacgtgcaactggccggcgcaatcaatctggcgcgcgacccgcgtaacggc
cgcaacttcgagtacctttccgaggacccgttgttgagtgccacgatggccgcggagtcg
atcatcgggattcagcagcagggtgtcattgcgacgacgaaacacttctcgctgaactgc
aacgaaaccaatcggcactggctggacgcggtcatcgatcccgacgcgcaccgcgagtcg
gacttgttggcgttcgagatcgtcatcgagcggtcgcagcccggcgccgtgatggcggcg
tacaacaaggtcaacggagattacgctgccggcaacgaccacttgctcaacgacgtgctg
aaaggtgcttggggataccgcggttgggtgatgtcggattggggcggaacacccagctgg
gagtgcgcgctggccggcctggaccaagagtgcggtgcgcagatcgatgcagtgctgtgg
cagtcggaagcattcaccgaccgcctgcgtgccgcctacgccgacggcaatctacccaag
gggcgcctgtcggacatggtacggcggatcctgcggtcgatgtttgccgtcggaatcgac
cgatggaaaccagcgccggcgccggacatgaatgcgcacaacgagattgccgcacagatg
gcgcggcaaggaatcgtgctgctgcaaaaccgagggctgctgccgctcgctcccgaatcg
gccgggcgtattgccgtcatcggcggctatgcacacctcggtgtgccagccggttacggt
tcgagcgccgtcaccccgccggggggctatgcgggcgtgataccgatcggtgggtctggc
ttggcagccgggttgcgtaatctctacctgctgccgtcaagcccgctgagtgagttgcga
aagcggttgcccaacgcgcagttcgagttcgatcctggcatcaacccggcggaggcggtg
ctggctgcgcggcgagcagacatcgcgatcgtgttcgcgatccgtgccgaaggagagggc
ttcgacagcgccgatctgtcgctgccatggggtcaggatgcgctgatcgccgcagtcgcg
tccgccaacgcgaataccgttgtggtgcttgagacgggcaacccggtgaccatgccctgg
cgcgactcggtgaacgccatcatgcaggcctggtatccgggccaggcgggtggccaggcc
gttgcggagattgtgaccgggcaggtgaatccttcgggccggctgccgatcaccttcccg
gtcgatctcggtcagacgccacgctcgcaaccgcccgagctcggtgccccgtgggggaca
tcgaccacgatccactacaccgagggcgccgatgttggttaccgctggtttgccagcaca
aatcagaccccgatgttcgcgttcggtcacggcttgtcctataccagtttcgagtatcgt
gacctggtggtgacgggcggccacaccgtgcacgccagtttcagcgttaccaacacgggc
gaccgcagcggggcggatgtcccgcagctgtatatgatcgcagctcccggcgaatcgcgg
ttgcggttgctgggattcgagcgggtcgagctcgaacccggccagactcggcgggtaagg
atcgaggcggacccgcgactgctcgcccgctacgacggcgaggccagaagctggcgcatc
gagccgggcggttacacggtggcggtgggcgcttcggcggtagcgctgaagctggcagcc
aaggtcaagctggccggccgtgggttcgggcggtga

DBGET integrated database retrieval system