KEGG   Mycobacterium tuberculosis H37Rv: Rv0189cHelp
Entry
Rv0189c           CDS       T00015                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rv0189c (ilvD)
   01230 Biosynthesis of amino acids
    Rv0189c (ilvD)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Rv0189c (ilvD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv0189c (ilvD)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Rv0189c (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(219996..221723)
Genome map
AA seq 575 aa AA seqDB search
MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDEDFAKPQIGVASSWNE
ITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEGMHFSLVSREVIADSVE
VVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAKLSDGSERDVTI
IDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANTMASAAEALGMSLPGSAAP
PATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAI
AHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHIGGVPVVMKALLDAGLLHGDC
LTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGITILHGSLAPEGAVVKTAGFDSD
VFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPKGGPGMREMLAITGAIKGAGLGK
DVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRNGDRIRLDVAGRVLDVLADPAEFA
SRQQDFSPPPPRYTTGVLSKYVKLVSSAAVGAVCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaaccaccgacgaagccgcttccgtctcgacggtcgccgacatcaagccccgc
agtcgagacgtcaccgacggcctggagaaggccgctgcccggggcatgttgagggcggtg
ggcatggacgacgaagacttcgcgaagccacagatcggggtcgcgtcgtcgtggaacgaa
atcacgccgtgcaatctctcattggaccggctggccaacgcggtcaaggagggggtgttt
tcggccggcggctatccgcttgagttcggcacgatctcggtttcggacggcatctccatg
ggtcatgaggggatgcacttctcgctggtttcccgtgaggtgatcgccgacagcgtcgaa
gtcgtgatgcaggccgaacgactcgacggttcggtgctgctggccggatgcgacaaatcg
ctgcccggaatgctgatggccgccgcacgactggatctggcggcggtgttcctctacgcg
ggctctattttgcccggccgggccaagctctccgacggtagcgaacgagacgtcaccatc
attgacgccttcgaggcggtcggagcgtgctctcgcggtttgatgagtcgcgccgacgtc
gatgccatcgagcgggcaatctgccccggcgaaggggcatgcggcggcatgtacaccgct
aacaccatggccagcgccgccgaggcgctcggcatgtcgttgccgggcagcgcggcaccg
ccggcgaccgaccgccggcgcgacgggttcgcgcgtcgcagcggtcaggccgtcgtcgag
ctgctgcgccgcggcatcaccgcccgcgacatcctcaccaaggaggcgttcgagaacgcc
atcgcggtggtaatggcgttcggcggctcgaccaacgcggtgctgcatctgctggccatc
gcccacgaggccaacgtcgcactatcgcttcaggacttcagccggatcgggtcgggggtg
ccgcatttggccgatgtcaagccgttcggccgccatgtgatgtccgacgtcgatcacatc
ggcggtgtgccggtggttatgaaggcgctgctggacgccggtctgctacacggcgactgc
ctgacggttaccggtcacaccatggccgagaatctggctgccatcaccccgccggatcca
gatggcaaggtgctacgtgcgttggcaaacccgatccacccgagcggtggcatcaccatc
ctgcacggatcgctggcacccgaaggtgcggtggtcaagaccgccggattcgattccgac
gtattcgaaggcaccgcaagagttttcgacggcgagcgcgctgcgctggacgcccttgag
gatggcaccattaccgtgggcgacgccgtggtaatccggtacgaaggacccaagggcggc
cccgggatgcgcgaaatgctcgccatcacaggcgcgatcaaaggcgcaggactcggtaaa
gatgttctactgctgaccgacggccggttctccggtggaaccaccggcctgtgcgttggc
cacatcgcaccggaggcggtcgacggcggaccgatcgcacttctgcgcaacggcgaccgg
atccggctcgacgtggccggccgcgttctcgatgtgttggccgatccggccgaattcgcg
tcccgacaacaggatttcagtcctccaccgccgcgctacactactggcgtactgtccaag
tacgtcaagctggtcagctctgccgcggtcggcgcggtctgcggctag

DBGET integrated database retrieval system