KEGG   Mycobacterium tuberculosis H37Rv: Rv0217cHelp
Entry
Rv0217c           CDS       T00015                                 

Gene name
lipW
Definition
(RefSeq) esterase LipW
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(259923..260831)
Genome map
AA seq 302 aa AA seqDB search
MSGNEVHPDLRRIAVVTPRQLVGPRTLPVMRALIVVAGLRMSRTPPDIEVLTLESGVGVR
LYRPAGSNEPAPALLWIHAGGYVMGTAQQDDRLCLRFSSRLGITVASVDYRLAPENPYPA
ALGDCYSALTWLASLPAVDPARVAIGGASAGGGLAAALALLARDRGGITPAFQLLVYPML
DDRPSIAPANPHYRLWNGRANRFGWRAYLGDADARVAVPGRRDDLGGLAPAWIGVGTHDL
LHDEDLAYAERLTAAGVPCQVEVVEGAFHGFDRVAPNVGVSQRFFTSQCNSLRAALALSN
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcaacgaagtccaccccgacctgcgtcgcatcgccgtcgtcaccccacgacag
ctggtcggtcctcgcaccctgccagtcatgcgggcattgatcgtcgtcgcggggcttcga
atgtcccgtacaccccccgatatcgaggtgctcaccctggaatccggggtcggtgtccgg
ctataccgacccgccggcagcaacgaaccagcgcccgcgctgctgtggatccacgccggc
ggatacgtaatgggcaccgcgcaacaggacgatcggctctgcctccggttcagcagcaga
ctgggcatcactgtcgcatcggtggactaccgcctggcgccggaaaatccgtatcctgcc
gccctgggcgactgctactcggcgttgacctggctggccagcctgccggcggtggacccc
gcgcgggtggcaatcggcggcgctagtgccggcggcggcctcgcggcggcgctggctctg
cttgcccgcgaccgtggcggcatcacaccggcatttcagttgctggtgtaccccatgctc
gacgaccggccgtcgatcgcccccgccaacccgcactaccggctatggaacgggcgcgcc
aaccggttcggctggcgggcatatcttggcgatgcggacgcacgggtcgcggtcccggga
cggcgtgacgacctaggagggctggcgccggcatggatcggcgtcggcacccacgacctg
ctccacgacgaggatctggcctatgccgaacgtctgacagcagccggggtgccatgccag
gtagaagtagtcgaaggcgccttccacggtttcgatcgtgtggccccgaatgttggggtc
tcacaaaggttcttcactagtcagtgcaacagtttgcgtgccgcgctggcccttagtaac
cgaacctag

DBGET integrated database retrieval system