KEGG   Mycobacterium tuberculosis H37Rv: Rv0234cHelp
Entry
Rv0234c           CDS       T00015                                 

Gene name
gabD1
Definition
(RefSeq) succinate-semialdehyde dehydrogenase
  KO
K00135  
succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Tyrosine metabolism
Butanoate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Rv0234c (gabD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0234c (gabD1)
   00310 Lysine degradation
    Rv0234c (gabD1)
   00350 Tyrosine metabolism
    Rv0234c (gabD1)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv0234c (gabD1)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Rv0234c (gabD1)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     Rv0234c (gabD1)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     Rv0234c (gabD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(279605..281140)
Genome map
AA seq 511 aa AA seqDB search
MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFVQTHPAKDVSVPIATI
NPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWANATADLLEAEADQAA
AMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADAAKVGASAAYGRYQPLGV
ILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTL
LVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKPTVLELGGSDPFIVMPSADL
DAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFVARMAALRVGDPTDPDTDVGP
LATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYPPTVITDISKDMALYTEEVFGP
VASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRRFIDDIVAGQVFINGMTVSYPEL
PFGGVKRSGYGRELSAHGIREFCNIKTVWIA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcggtgacatgttccgccacgctggtcctgcccgtgatagagcccaccccagcc
gataggaggccccgacacctcctgctcgggagcgctggccacgttagtggcaggctggac
accggacgatttgtgcaaacccacccagcaaaggatgtcagcgtgcccatcgccaccatc
aacccggctaccggcgaaacagtcaagacattcactgcggcgaccgatgacgaagtcgac
gcggcaatagcccgggcccaccggcggttcgccgactaccgccagaccagcttcgcccag
cgcgcccggtgggccaatgccaccgccgacttgctggaagccgaggccgaccaggccgcc
gcgatgatgacgctcgagatgggcaagacgctggccgcggccaaagccgaggcactgaag
tgcgccaagggttttcgctactacgccgaaaacgccgaggcgttgctggccgacgaaccc
gccgatgcggccaaggtcggggcgtcggcggcctacggccgataccagccgctcggggtg
atcctggcggtgatgccatggaacttccccctgtggcaagcggttcggttcgccgcaccg
gcactgatggccggaaacgtcggcctgctcaagcacgcgtcgaacgtgccgcaatgcgcg
ctgtacctggccgacgtcatcgcccgaggcggcttcccggacggctgcttccagacgttg
cttgttagctcgggagccgtcgaagccatcctgcgtgatccccgggtcgcggcggccacg
ctgaccggaagcgagccggccggccaatcggtgggcgctatcgccggtaacgagatcaag
ccgaccgtgctcgagctcggcggcagcgacccgttcatcgttatgccgtcggccgatctg
gacgccgcggtcagcaccgccgtcaccggccgggtgcagaacaacggccaatcctgcatc
gccgccaagcggttcatcgtccacgccgacatttacgacgatttcgtcgacaagttcgtc
gcgcggatggcggcgttacgggtcggcgacccgaccgacccggacaccgacgtgggcccg
ctggccaccgagcagggccgcaacgaggttgccaagcaagtcgaggatgctgccgcggcg
ggcgcggtgatccggtgcggcggaaagcgtctcgaccggccgggctggttctacccgccg
accgtgatcaccgacatctccaaggacatggctctctacaccgaggaggtcttcggtccg
gtcgcctcggtgttccgcgcggcgaacatcgacgaggccgtcgagatcgccaacgccacc
accttcgggctgggatccaacgcctggacccgcgacgagaccgagcaacgacgcttcatc
gacgacatcgtggcgggccaggtttttatcaacggcatgacggtgtcctatcccgaattg
ccgttcggcggggtcaagcgctcgggctatggccgggaactgtccgcacacgggatacgc
gagttctgcaacatcaagaccgtctggatcgcctag

DBGET integrated database retrieval system