KEGG   Mycobacterium tuberculosis H37Rv: Rv0254cHelp
Entry
Rv0254c           CDS       T00015                                 

Gene name
cobU
Definition
(RefSeq) bifunctional cobinamide kinase/cobinamide phosphate guanylyltransferase
  KO
K02231  
adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC:2.7.1.156 2.7.7.62]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0254c (cobU)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.156  adenosylcobinamide kinase
     Rv0254c (cobU)
   2.7.7  Nucleotidyltransferases
    2.7.7.62  adenosylcobinamide-phosphate guanylyltransferase
     Rv0254c (cobU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(305825..306349)
Genome map
AA seq 174 aa AA seqDB search
MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDARVALHRARRPPTWLT
VETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVYAVLEARLDGLCAALTG
LPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEVHLVIAGRVLKL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgcggatactggtcactggcggcgtccgctcgggaaagtccacgcacgccgaagcgttg
ttgggcgatgcggccgacgtcgtctacgtcgcgcctggccgcccggccgctggcagcgat
cccgattgggacgcccgggtcgcactgcatcgcgctcgccgcccaccgacctggctaacg
gtggaaacggccgacgtcgcgacggctttgtccgaggcacgaagtcccgtgctcgtggac
tgcttgggcacctggctgacggccatcatggatggcgaggcgttgtggtctgctgcgacc
gcggacgtctacgccgtcctcgaggcacggctcgacgggttgtgcgccgcgctgaccgga
ttgcccactgcgatcgtggtgacgaacgaggtcggcctcggggtggtgccatcccattct
tcgggcgtgctgtttcgcgatctactgggcacaatcaaccgacgcgtggcagccgtctgc
gatgaggtacatctggtcatcgccggacgtgtgctcaagctgtga

DBGET integrated database retrieval system