KEGG   Mycobacterium tuberculosis H37Rv: Rv0255cHelp
Entry
Rv0255c           CDS       T00015                                 

Gene name
cobQ1
Definition
(RefSeq) cobyric acid synthase
  KO
K02232  
adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0255c (cobQ1)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Rv0255c (cobQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(306374..307858)
Genome map
AA seq 494 aa AA seqDB search
MSGLLVAGTTSDAGKSAVTAGLCRALARRGVRVAPFKAQNMSNNSMVCRGPDGTGVEIGR
AQWVQALAARTTPEAAMNPVLLKPASDHRSHVVLMGKPWGEVASSSWCAGRRALAEAACR
AFDALAARYDVVVAEGAGSPAEINLRAGDYVNMGLARHAGLPTIVVGDIDRGGVFAAFLG
TVALLAAEDQALVAGFVVNKFRGDSDLLAPGLRDLERVTGRRVYGTLPWHPDLWLDSEDA
LDLQGRRAAGTGARRVAVVRLPRISNFTDVDALGLEPDLDVVFASDPRALDDADLIVLPG
TRATIADLAWLRARDLDRALLVHVAAGKPLLGICGGFQMLGRVIRDPYGIEGPGGQVTEV
EGLGLLDVETAFSPHKVLRLPRGEGLGVPASGYEIHHGRITRGDTAEEFLGGARDGPVFG
TMWHGSLEGDALREAFLRETLGLAPSGSCFLAARERRLDLLGDLVERHLDVDALLNLARH
GCPPTLPFLAPGAP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctgctggtcgcgggtacgacaagcgacgccggtaagagcgccgtgaccgcg
gggctgtgccgcgcgttggcccgacgcggtgtgcgggtggcgccgtttaaggcgcagaac
atgtccaacaactcgatggtctgccgaggccccgacggcacgggcgtggagatcggtcgg
gcgcaatgggtgcaggcactcgcggctaggaccacgcccgaggcggcgatgaacccggtc
ttgctcaagccggccagtgatcaccgcagccacgtggtgttgatgggcaagccctggggc
gaggtggcgtcgtcaagctggtgtgcggggcggcgagcgctcgccgaggccgcatgccgc
gccttcgacgccctcgccgcccgctacgacgtcgttgtcgcggagggcgccggcagcccg
gccgaaatcaacctgcgcgcaggtgactacgtcaacatggggcttgcccgtcatgcggga
ctgccgaccatcgtcgtcggtgacatcgaccgcggcggggtgttcgctgcgttcctgggc
accgtcgcgttgctggctgccgaggaccaggcgctggtcgcggggtttgtggtcaataag
tttcggggcgactccgacctgctggcgccaggtctgcgcgacctggaacgggtcaccggg
cgcagggtgtacggcaccctgccgtggcaccccgacctctggctggactccgaagatgcc
ctcgacctacagggccggcgcgcggcgggcaccggggcccgccgggtagccgtcgtgcgc
ctgccacgaatcagcaacttcaccgatgtcgacgcattgggtcttgagcccgacttggat
gtcgtgttcgcttccgacccccgcgcgctggacgatgccgatctgatcgtgttgccgggc
acccgggcaacgatcgccgatctagcctggctgagggcgcgagacctagatcgtgcgctg
ctggtgcatgttgcggcgggcaagccgctgctcggcatttgtggcgggttccagatgctg
ggccgggtgattcgcgacccgtacggcatcgaaggtccgggagggcaggtgaccgaggtc
gagggcttgggtttgctcgacgtggagaccgcattttccccccacaaggtgctgcggcta
ccgcgcggcgaaggactcggtgtgcccgcgtcggggtacgagattcaccacggccggatc
acccgcggtgacaccgccgaggagttcctcggcggcgcgcgcgacggaccggtgttcggc
accatgtggcacggctcgttggaaggcgacgccctgcgcgaggccttcctgcgagagacg
ctcggcctcgccccgtcgggctcatgcttcctggccgcacgcgagcgccgcctcgacctg
ctcggcgatctcgtcgaacgacacctcgacgtcgatgcgctgctcaacctggcccgccat
ggttgcccgccgaccttgccctttctcgctccgggcgcgccatga

DBGET integrated database retrieval system