KEGG   Mycobacterium tuberculosis H37Rv: Rv0321Help
Entry
Rv0321            CDS       T00015                                 

Gene name
dcd
Definition
(RefSeq) deoxycytidine triphosphate deaminase
  KO
K01494  
dCTP deaminase [EC:3.5.4.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv0321 (dcd)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     Rv0321 (dcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
388582..389154
Genome map
AA seq 190 aa AA seqDB search
MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTHIDPAKQQDEL
TSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDP
GFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYGSSRAGSKYQGQRGPTPS
RSYQNFIRST
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctctccgatcgtgatcttcgggccgagatctcctccgggcggttggggatcgac
ccgttcgacgacaccctggtccagccgtccagcatcgacgtccggctcgattgcttgttt
cgggtgttcaacaacactcgctacacccacatcgacccggccaagcagcaggacgagctg
accagcctggtgcaaccggtcgacggggaacccttcgtgttgcacccgggcgaattcgtg
ctcggctcgacgctggagcttttcactctgcccgacaacctcgccggacggctggaaggc
aagtcttcgttgggccggctgggcctgctgacgcattccaccgcgggcttcatcgatcct
ggcttcagcggtcacatcaccctggagctatccaacgtcgccaacctgccgatcactttg
tggcccggcatgaaaatcggtcagctgtgcatgttgcgcctgaccagcccgtccgagcat
ccctacggcagttcccgggcggggtcgaaataccagggtcagcgcgggcccacgccgtcg
cgctcctaccagaacttcatcaggtctacttag

DBGET integrated database retrieval system