KEGG   Mycobacterium tuberculosis H37Rv: Rv0334Help
Entry
Rv0334            CDS       T00015                                 

Gene name
rmlA
Definition
(RefSeq) glucose-1-phosphate thymidylyltransferase
  KO
K00973  
glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Acarbose and validamycin biosynthesis
Biosynthesis of antibiotics
Module
dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rv0334 (rmlA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rv0334 (rmlA)
   00525 Acarbose and validamycin biosynthesis
    Rv0334 (rmlA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     Rv0334 (rmlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
398658..399524
Genome map
AA seq 288 aa AA seqDB search
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPG
FHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSL
KRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVI
EIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLE
RRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggatcatcttggccggcggttcgggcacccggctgtacccgatcaccatgggg
atcagcaagcagctgctgccggtctacgacaaaccgatgatctactacccgctcaccacg
ctgatgatggctgggatccgagacattcagttgatcaccaccccgcatgacgcgcccggc
tttcatcgactcctgggcgacggcgcgcacttgggagtgaacatcagctacgccacccag
gatcagcctgacggtctggcgcaggcgttcgtcattggcgccaaccacatcggcgccgat
tcggtggcattggtgttgggggacaacatcttctacggcccaggtctggggaccagcctg
aagcgcttccaatccatcagtggtggagcaattttcgcctattgggtagccaacccgtcg
gcctatggtgtcgttgagttcggcgccgagggcatggcgctgtctctggaggagaagccg
gtgaccccgaagtcgaattacgcggtgccgggcctgtatttctatgacaacgatgtgatc
gaaatcgccaggggtttaaagaaatcagcgcgcggggagtacgagatcaccgaggtcaac
caggtctacctcaatcagggtaggttggcggtcgaggtgctggcccgcgggacagcgtgg
ctggacaccgggacattcgactcgctgctggacgccgccgatttcgtccggaccctggag
cgtcggcagggcctgaaggtcagcatccccgaagaagtggcgtggcgcatgggctggatc
gacgacgagcagctggtgcagcgagcccgtgctctggtcaagtccggatatggtaactac
ctgctggagttgttggagcgcaactga

DBGET integrated database retrieval system