KEGG   Mycobacterium tuberculosis H37Rv: Rv0357cHelp
Entry
Rv0357c           CDS       T00015                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  
adenylosuccinate synthase [EC:6.3.4.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv0357c (purA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0357c (purA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Rv0357c (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(435471..436769)
Genome map
AA seq 432 aa AA seqDB search
MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGENFALHLIPSGV
LTPGVTNVIGNGVVIDPGVLLNELRGLQDRGVDTAKLLISADAHLLMPYHIAIDKVTERY
MGSKKIGTTGRGIGPCYQDKIARIGIRVADVLDPEQLTHKVEAACEFKNQVLVKIYNRKA
LDPAQVVDALLEQAEGFKHRIADTRLLLNAALEAGETVLLEGSQGTLLDVDHGTYPYVTS
SNPTAGGAAVGSGIGPTRIGTVLGILKAYTTRVGSGPFPTELFDEHGEYLSKTGREFGVT
TGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLESVPVCVGYEIDGRRTRDMPMT
QRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVLRLEQLAGAPVSCIGVGPGREQ
TIVRRDVLQDRP
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgatcgtcctcatcggcgcccaatggggcgacgagggcaagggtaaggccacc
gacctgttgggtggccgcgtgcagtgggtggtgcgctatcaggggggcaacaacgccggg
cacaccgtcgtcttgcctaccggcgagaatttcgcattgcatctcatcccgtcgggtgtg
ctgacgcccggggtcaccaacgttatcggcaacggcgtggtgatcgatcccggtgtcctg
ctcaatgagctgcggggactgcaagaccgcggcgtggacaccgccaagctgttgatctcc
gccgacgcccatctgctgatgccttaccacattgctatcgacaaggtcaccgagcgctat
atgggcagcaagaagatcggcaccaccggccgtggtatcgggccgtgctaccaggacaag
atcgcccgtattgggatccgggtcgccgatgtgctggacccggaacaattgacccacaag
gtcgaggccgcgtgcgagttcaagaaccaagtgctggtcaagatctacaaccgcaaggcc
ctggaccccgcgcaggtggtcgacgcgctgctggagcaggccgagggtttcaagcatcgc
atcgccgacacccggctgctactcaatgctgccctggaggccggcgaaacggtgctgctg
gaaggctctcaaggcaccctgctcgatgtcgaccacggcacctacccgtatgtgacatcg
tcgaatccgacggcgggtggcgcggccgtgggctctggtatcggcccgacccgcatcggc
accgtgctggggattctcaaggcctacaccactcgggtgggctccggcccgttccccacc
gagctgttcgacgaacacggcgaatacctgtccaagactggccgcgagttcggtgtgacc
accggccggcgccggcgctgcggctggttcgacgccgtcattgcccgctacgccgcccgg
gtcaacggcatcaccgactacttcctgaccaagctcgacgtgctgtccagcctggaatcg
gtgccggtctgcgtcggatatgagatcgacggccggcgcacccgcgatatgccgatgacc
cagcgggatctttgccgcgccaagccggtttacgaggagctgccgggctggtgggaagac
atctccggggcgcgcgagttcgacgacctgcccgccaaagcgcgtgattatgtgctgcga
ctggaacagcttgccggagcaccggtttcgtgcattggagtcggtccggggcgggaacag
accatcgtgcgccgggacgtcctgcaggatcgcccgtga

DBGET integrated database retrieval system