KEGG   Mycobacterium tuberculosis H37Rv: Rv0382cHelp
Entry
Rv0382c           CDS       T00015                                 

Gene name
pyrE
Definition
(RefSeq) orotate phosphoribosyltransferase
  KO
K00762  
orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv0382c (pyrE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     Rv0382c (pyrE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(457841..458380)
Genome map
AA seq 179 aa AA seqDB search
MAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTAD
WDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQRLIEGSEVTGQRVLVVE
DTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAEGLRYRSVLGLADLGLD
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtggccggacctgaccgcgcagagttggctgagttggtgcgccggctgtcggtggtgcac
ggccgcgtcacgctgtcgtctggccgggaggccgactactacgtcgacctgcgtcgcgcc
accttgcaccatcgggcgtccgcgctgatcggccggctaatgcgcgaactcactgccgac
tgggactattcggttgtcggcggcctgacactcggggccgatcccgtggcgaccgccatc
atgcatgccccgggccgtccgatcgacgcgttcgtggtccgcaagtcggcgaaagcccat
ggcatgcagcgacttatcgaagggtcggaggttaccgggcagcgggtgctggtggtagag
gacaccagtaccaccggtaactccgcgctgacggcggtgcacgccgtccaagacgtgggt
ggtgaggttgtcggcgtggctaccgtggtggatcgcgccaccggggccgcagaggctatc
gaagccgagggactgcgctaccgcagcgtgctgggcctggccgatctggggctggattag

DBGET integrated database retrieval system