KEGG   Mycobacterium tuberculosis H37Rv: Rv0409Help
Entry
Rv0409            CDS       T00015                                 

Gene name
ackA
Definition
(RefSeq) acetate kinase
  KO
K00925  
acetate kinase [EC:2.7.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
   00620 Pyruvate metabolism
    Rv0409 (ackA)
   00640 Propanoate metabolism
    Rv0409 (ackA)
  Energy metabolism
   00680 Methane metabolism
    Rv0409 (ackA)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Rv0409 (ackA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Rv0409 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
493851..495008
Genome map
AA seq 385 aa AA seqDB search
MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVADHAQALHRAFKMLAED
GIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALAPLHNPPAVLGIKVARR
LLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGFHGTSHQYVSERAAAFLG
RPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVMGTRSGDLDPGVISYLWRT
ARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSAQLAYEVFIHRLRKYLGAYL
AVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQDRNLGPGHGARRISSDDSPIA
VLVVPTNEELAIARDCLRVLGGRRA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaccgtgctggtgatcaattccggctcgtcgtcgctgaagttccagctcgtc
gagccggtcgccggcatgtcacgtgccgccgggattgtcgagcggatcggcgagcggtca
tccccggttgccgatcacgcccaggcgctgcatcgcgcattcaagatgttggccgaggac
ggaattgacctgcagacctgcgggctggtggcggtcggacaccgggtggtccacggcggc
acggagtttcaccagccgacgctgctggatgacacggtgatcggcaagcttgaggagctg
tcggcgctggccccgttgcacaacccgccggcggtactgggcatcaaggtggcacgcaga
ttgctggccaatgtcgcgcacgtcgcggtgttcgatacggcctttttccatgacttgccc
ccggcggccgcgacctatgccatcgaccgcgacgtcgccgacagatggcatatccgccgc
tacggatttcatggcacttcacaccaatacgtcagcgagcgggccgccgccttcctgggc
cgcccgctcgacggtttgaatcagattgtgctgcatctgggtaacggtgcctccgcctcg
gcgattgcccgcggccggccggtggaaacgtcgatgggcctgacaccgcttgagggcttg
gtgatgggcacccgcagtggcgacctggacccgggcgtcatcagctacttgtggcgcacc
gcgaggatgggtgtcgaggacatcgaatcgatgctcaaccatcggtccgggatgttgggg
ttggcgggggagcgggattttcgccgtctacgactagtgatcgaaaccggggacaggtca
gcacaattggcgtatgaggtgttcatccaccggttgcgcaagtaccttggtgcctatctg
gcggtgttgggccacaccgatgtggtgagctttaccgccgggatcggcgaaaacgatgcg
gcggtgcggcgggacgcgttggctggccttcaggggctaggtatcgcactcgaccaagac
cgcaacctgggcccggggcacggcgcccggcggatttcgtcagacgattcaccgatcgcc
gtgctggtggttcccacgaatgaagaactggccatcgcccgcgattgcctgagggtgctg
ggcggacgccgagcgtga

DBGET integrated database retrieval system