KEGG   Mycobacterium tuberculosis H37Rv: Rv0409Help
Entry
Rv0409            CDS       T00015                                 

Gene name
ackA
Definition
(RefSeq) acetate kinase
  KO
K00925  
acetate kinase [EC:2.7.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv0409 (ackA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv0409 (ackA)
   00640 Propanoate metabolism
    Rv0409 (ackA)
  Energy metabolism
   00680 Methane metabolism
    Rv0409 (ackA)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Rv0409 (ackA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Rv0409 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
493851..495008
Genome map
AA seq 385 aa AA seqDB search
MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVADHAQALHRAFKMLAED
GIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALAPLHNPPAVLGIKVARR
LLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGFHGTSHQYVSERAAAFLG
RPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVMGTRSGDLDPGVISYLWRT
ARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSAQLAYEVFIHRLRKYLGAYL
AVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQDRNLGPGHGARRISSDDSPIA
VLVVPTNEELAIARDCLRVLGGRRA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcaccgtgctggtgatcaattccggctcgtcgtcgctgaagttccagctcgtc
gagccggtcgccggcatgtcacgtgccgccgggattgtcgagcggatcggcgagcggtca
tccccggttgccgatcacgcccaggcgctgcatcgcgcattcaagatgttggccgaggac
ggaattgacctgcagacctgcgggctggtggcggtcggacaccgggtggtccacggcggc
acggagtttcaccagccgacgctgctggatgacacggtgatcggcaagcttgaggagctg
tcggcgctggccccgttgcacaacccgccggcggtactgggcatcaaggtggcacgcaga
ttgctggccaatgtcgcgcacgtcgcggtgttcgatacggcctttttccatgacttgccc
ccggcggccgcgacctatgccatcgaccgcgacgtcgccgacagatggcatatccgccgc
tacggatttcatggcacttcacaccaatacgtcagcgagcgggccgccgccttcctgggc
cgcccgctcgacggtttgaatcagattgtgctgcatctgggtaacggtgcctccgcctcg
gcgattgcccgcggccggccggtggaaacgtcgatgggcctgacaccgcttgagggcttg
gtgatgggcacccgcagtggcgacctggacccgggcgtcatcagctacttgtggcgcacc
gcgaggatgggtgtcgaggacatcgaatcgatgctcaaccatcggtccgggatgttgggg
ttggcgggggagcgggattttcgccgtctacgactagtgatcgaaaccggggacaggtca
gcacaattggcgtatgaggtgttcatccaccggttgcgcaagtaccttggtgcctatctg
gcggtgttgggccacaccgatgtggtgagctttaccgccgggatcggcgaaaacgatgcg
gcggtgcggcgggacgcgttggctggccttcaggggctaggtatcgcactcgaccaagac
cgcaacctgggcccggggcacggcgcccggcggatttcgtcagacgattcaccgatcgcc
gtgctggtggttcccacgaatgaagaactggccatcgcccgcgattgcctgagggtgctg
ggcggacgccgagcgtga

DBGET integrated database retrieval system