KEGG   Mycobacterium tuberculosis H37Rv: Rv0410cHelp
Entry
Rv0410c           CDS       T00015                                 

Gene name
pknG
Definition
(RefSeq) serine/threonine-protein kinase PknG
  KO
K14949  
serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    Rv0410c (pknG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Rv0410c (pknG)
Protein kinases [BR:mtu01001]
 Serine/threonine protein kinases: Other group
  Bacterial family
   Rv0410c (pknG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(495062..497314)
Genome map
AA seq 750 aa AA seqDB search
MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
LRSLARVAPTQRHRYTLVDMANKVRPTSTF
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcgtcagagaccgaacgttcgggccccggcacccaaccggcggacgcccag
accgcgacgtccgcgacggttcgacccctgagcacccaggcggtgttccgccccgatttc
ggcgatgaggacaacttcccccatccgacgctcggcccggacaccgagccgcaagaccgg
atggccaccaccagccgggtgcgcccgccggtcagacggctgggcggcggcctggtggaa
atcccgcgggcgcccgatatcgatccgcttgaggccctgatgaccaacccggtggtgccg
gagtccaagcggttctgctggaactgtggacgtcccgtcggccggtccgactcggagacc
aagggagcttcagagggctggtgtccctattgcggcagcccgtattcgttcctgccgcag
ctaaatcccggggacatcgtcgccggccagtacgaggtcaaaggctgcatcgcgcacggc
ggactgggctggatctacctcgctctcgaccgcaatgtcaacggccgtccggtggtgctc
aagggcctggtgcattccggtgatgccgaagcgcaggcaatggcgatggccgaacgccag
ttcctggccgaggtggtgcacccgtcgatcgtgcagatcttcaactttgtcgagcacacc
gacaggcacggggatccggtcggctacatcgtgatggaatacgtcggcgggcaatcgctc
aaacgcagcaagggtcagaaactgcccgtcgcggaggccatcgcctacctgctggagatc
ctgccggcgctgagctacctgcattccatcggcttggtctacaacgacctgaagccggaa
aacatcatgctgaccgaggaacagctcaagctgatcgacctgggcgcggtatcgcggatc
aactcgttcggctacctctacgggaccccaggcttccaggcgcccgagatcgtgcggacc
ggtccgacggtggccaccgacatctacaccgtgggacgcacgctcgcggcgctcacgctg
gacctgcccacccgcaatggccgttatgtggatgggctacccgaagacgacccggtgctg
aaaacctacgactcttacggccggttgctgcgcagggccatcgaccccgatccgcggcaa
cggttcaccaccgccgaagagatgtccgcgcaattgacgggcgtgttgcgggaggtggtc
gcccaggacaccggggtgccgcggccagggctatcaacgatcttcagtcccagtcggtcg
acatttggagtggacctgctggtggcgcacaccgacgtgtatctggacgggcaggtgcac
gcggagaagctgaccgccaacgagatcgtgaccgcgctgtcggtgccgctggtcgatccg
accgacgtcgcagcttcggtcctgcaggccacggtgctctcccagccggtgcagacccta
gactcgctgcgcgcggcccgccacggtgcgctggacgccgacggcgtcgacttctccgag
tcagtggagctgccgctaatggaagtccgcgcgctgctggatctcggcgatgtggccaag
gccacccgaaaactcgacgatctggccgaacgcgttggctggcgatggcgattggtctgg
taccgggccgtcgccgagctgctcaccggcgactatgactcggccaccaaacatttcacc
gaggtgctggatacctttcccggcgagctggcgcccaagctcgccctggccgccaccgcc
gaactagccggcaacaccgacgaacacaagttctatcagacggtgtggagcaccaacgac
ggcgtgatctcggcggctttcggactggccagagcccggtcggccgaaggtgatcgggtc
ggcgccgtgcgcacgctcgacgaggtaccgcccacttctcggcatttcaccacggcacgg
ctgaccagcgcggtgactctgttgtccggccggtcaacgagtgaagtcaccgaggaacag
atccgcgacgccgcccgaagagtggaggcgctgcccccgaccgaaccacgcgtgctgcag
atccgcgccctggtgctgggtggcgcgctggactggctgaaggacaacaaggccagcacc
aaccacatcctcggtttcccgttcaccagtcacgggctgcggctgggtgtcgaggcgtca
ctgcgcagcctggcccgggtagctcccactcaacggcatcgctacacgctggtggacatg
gccaacaaggtccggcccaccagcacgttctaa

DBGET integrated database retrieval system