KEGG   Mycobacterium tuberculosis H37Rv: Rv0414cHelp
Entry
Rv0414c           CDS       T00015                                 

Gene name
thiE
Definition
(RefSeq) thiamine-phosphate synthase
  KO
K00788  
thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv0414c (thiE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     Rv0414c (thiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(500350..501018)
Genome map
AA seq 222 aa AA seqDB search
MHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDE
LAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRS
THDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVAAELGGDDKPWFAIGGIN
AQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgaatcccgtctggcatcggcaaggctgtatctgtgcaccgacgcccgtcgggaa
cgcggcgacttggctcagttcgccgaggccgccctggccggcggagtggacatcatccag
ttgcgcgacaagggctcacccggtgagctgcggttcggcccgctacaggcgcgtgacgaa
ctggccgcctgcgagatcctggccgacgcagcgcaccggtacggcgccctattcgcggtc
aacgaccgcgccgatattgcccgcgcggccggcgccgacgtgctgcatctgggtcaacgc
gacctgcccgtgaacgtcgcacgacagatcctggcaccggataccctcatcggccggtcc
acccacgaccccgaccaggttgctgcggccgccgccggcgacgccgactatttctgtgtc
ggaccatgttggccgacaccgaccaagcctggccgtgcggcgccgggtctggggctggta
cgggtcgccgccgaactcggcggcgacgacaagccgtggttcgctatcggcggcatcaac
gcgcaacggctgccggccgtgctcgatgccggcgctcgccggatcgtggtggtgcgggcg
atcacctcggctgacgacccacgtgcggcggccgagcagctccggtcggcgcttacagca
gcgaactga

DBGET integrated database retrieval system